(data stored in ACNUC7421 zone)

EMBL: CP000431.PE36

CP000431.PE36        Location/Qualifiers
FT   CDS             complement(42216..42677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00036"
FT                   /product="possible cAMP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00036"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91872"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKR4"
FT                   /protein_id="ABG91872.1"
FT                   /translation="MNADESTLPPVLGRLDHQHRLRLAELSTPVRFAAGEFVFRENEPA
FT                   TRCWLLGTGSVVLTTLVPGRGTVALETLHGGDVLGWSWLGARQVWQFDAQATTTTDAAE
FT                   VDVAALEQMALSRPDFGYAVTRALSGVLIARLQSTRARLLDLYANRGDR"
     MNADESTLPP VLGRLDHQHR LRLAELSTPV RFAAGEFVFR ENEPATRCWL LGTGSVVLTT        60
     LVPGRGTVAL ETLHGGDVLG WSWLGARQVW QFDAQATTTT DAAEVDVAAL EQMALSRPDF       120
     GYAVTRALSG VLIARLQSTR ARLLDLYANR GDR                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page