(data stored in ACNUC7421 zone)

EMBL: CP000431.PE38

CP000431.PE38        Location/Qualifiers
FT   CDS             complement(43864..44145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00038"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00038"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91874"
FT                   /db_xref="InterPro:IPR015057"
FT                   /db_xref="InterPro:IPR038070"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKR2"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91874.1"
FT                   /translation="MNEKTWSVEIVIDEHDADEGGSRTRAQARLRTRDTHTLVGVGLAR
FT                   RNPADTEIPEIGDELATARALADLAHQLIELTAADVEAATHSRVHLTE"
     MNEKTWSVEI VIDEHDADEG GSRTRAQARL RTRDTHTLVG VGLARRNPAD TEIPEIGDEL        60
     ATARALADLA HQLIELTAAD VEAATHSRVH LTE                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page