(data stored in ACNUC7421 zone)

EMBL: CP000431.PE39

CP000431.PE39        Location/Qualifiers
FT   CDS             complement(44222..45643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00039"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00039"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91875"
FT                   /db_xref="GOA:Q0SKR1"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKR1"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91875.1"
FT                   /translation="MTDVITTNQRYMTQTDFMSWRMEEDPILRSTIVAVALLDRRPDQS
FT                   RFVDMMRRAVDLVPLFRRTAIEDPLGLAPPRWADDRDFDLSWHLRRYTLAEPRTWDGVL
FT                   DFARTAEMTAFDKRRPLWEFTILDGLNDGRSALVMKVHHSLTDGVSGMQIAREIVDFTR
FT                   EGTPRPGRTDRATAVPHGGSSRPPSRLSWYRDTAADVTHRAANILGRNSVRLVRAPRAT
FT                   WREATALAGSTLRLTRPVVSTLSPVMTKRSTRRHCAVIDVPVEALAQAAAAAAGSINDA
FT                   FLAAVLLGMAKYHRLHGAEIRELRMTLPISLRTETDPLGGNRISLARFALPTDIDDPAE
FT                   LMRRVHATVDAWRREPAIPFSPMIAGAVNLLPASTLGNMLKHVDFVASNVAGSPVPLFI
FT                   AGSEILHYYAFSPTLGSAFNVTLMSYTTQCCVGINADTDAVPDLATLTESLADGFRAVL
FT                   GLCAKTTDTRVVVAS"
     MTDVITTNQR YMTQTDFMSW RMEEDPILRS TIVAVALLDR RPDQSRFVDM MRRAVDLVPL        60
     FRRTAIEDPL GLAPPRWADD RDFDLSWHLR RYTLAEPRTW DGVLDFARTA EMTAFDKRRP       120
     LWEFTILDGL NDGRSALVMK VHHSLTDGVS GMQIAREIVD FTREGTPRPG RTDRATAVPH       180
     GGSSRPPSRL SWYRDTAADV THRAANILGR NSVRLVRAPR ATWREATALA GSTLRLTRPV       240
     VSTLSPVMTK RSTRRHCAVI DVPVEALAQA AAAAAGSIND AFLAAVLLGM AKYHRLHGAE       300
     IRELRMTLPI SLRTETDPLG GNRISLARFA LPTDIDDPAE LMRRVHATVD AWRREPAIPF       360
     SPMIAGAVNL LPASTLGNML KHVDFVASNV AGSPVPLFIA GSEILHYYAF SPTLGSAFNV       420
     TLMSYTTQCC VGINADTDAV PDLATLTESL ADGFRAVLGL CAKTTDTRVV VAS              473
//

If you have problems or comments...

PBIL Back to PBIL home page