(data stored in ACNUC7421 zone)

EMBL: CP000431.PE4

CP000431.PE4         Location/Qualifiers
FT   CDS             complement(6182..6940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00004"
FT                   /product="probable dehydrogenase"
FT                   /note="GO_function: GO:0004022 - alcohol dehydrogenase
FT                   activity; GO_function: GO:0004316 - 3-oxoacyl-[acyl-carrier
FT                   protein] reductase activity; GO_process: GO:0008152 -
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00004"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91840"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKU6"
FT                   /protein_id="ABG91840.1"
FT                   /translation="MHKVLPGLGEPTCWASPQGVTPTLRRGAPPVVSEQVVDRIRAELR
FT                   STISNWRTPIFELRRRCVRTRATARVRADLPVCPDTRELGDRTEYGKNLRRGSVREVGL
FT                   THRLFDSVERELGNVAALVFCHCESVDSGRLDTTVESFDRHFAVSTRASWLLIRGYGLR
FT                   FRGQHGTGRVVSLTSDHTVGNLACGASKGAMDRITLAAARELADLGVTCNAINPGPTDT
FT                   GWMNRTAEGAHDHLHISGTPRYTAGLARIW"
     MHKVLPGLGE PTCWASPQGV TPTLRRGAPP VVSEQVVDRI RAELRSTISN WRTPIFELRR        60
     RCVRTRATAR VRADLPVCPD TRELGDRTEY GKNLRRGSVR EVGLTHRLFD SVERELGNVA       120
     ALVFCHCESV DSGRLDTTVE SFDRHFAVST RASWLLIRGY GLRFRGQHGT GRVVSLTSDH       180
     TVGNLACGAS KGAMDRITLA AARELADLGV TCNAINPGPT DTGWMNRTAE GAHDHLHISG       240
     TPRYTAGLAR IW                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page