(data stored in ACNUC7421 zone)

EMBL: CP000431.PE40

CP000431.PE40        Location/Qualifiers
FT   CDS             complement(45853..46104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00040"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91876"
FT                   /db_xref="GOA:Q0SKR0"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKR0"
FT                   /protein_id="ABG91876.1"
FT                   /translation="MYDDDVGGWGYALMFTGMALIWGLLIVGIILLIRYVSHPFPAPPG
FT                   EPPHRSAEAVLAERFARGEIDEQEYRNRLSILRAGTTP"
     MYDDDVGGWG YALMFTGMAL IWGLLIVGII LLIRYVSHPF PAPPGEPPHR SAEAVLAERF        60
     ARGEIDEQEY RNRLSILRAG TTP                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page