(data stored in ACNUC7421 zone)

EMBL: CP000431.PE41

CP000431.PE41        Location/Qualifiers
FT   CDS             46395..47549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00041"
FT                   /product="probable penicillin-binding protein"
FT                   /note="GO_component: GO:0005618 - cell wall; GO_function:
FT                   GO:0016787 - hydrolase activity; GO_process: GO:0000902 -
FT                   cellular morphogenesis; GO_process: GO:0009252 -
FT                   peptidoglycan biosynthesis; GO_process: GO:0046677 -
FT                   response to antibiotic"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00041"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91877"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKQ9"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91877.1"
FT                   /translation="MMLVDPRFGELAGQFFRLFGQPSDGGGALALYLHGEPVVDIWSGW
FT                   AARDTRWQSDTVSVSFSTGKGVASTVLHRLVDRGLIDYDAPVATYWPEFASAGKELVTV
FT                   RDLLTHRAGLHRVRGLVPGRAALFDHDSVVGALASAAPDRRRAVMPGYHAVTFGSLVAE
FT                   LTTRATGSSFTDLVRTEIAEPLGIREFWFQVPAEERHRIAKSFPRITPFGVPWETASFA
FT                   LSCLPVLRNIAHAGMPEGFDELVRNPAIHDYVMPGWNGVFSARALARMYAALANKGMVG
FT                   GRRFLTEDTLAQIGEVQTTARDYVLGIRMNWRLGYHAAFVASRNQYPHAFGHYGLGGSG
FT                   AFADPETGLSVAFVTNRMGGALTPLADLRLAKLGAQAESIARRL"
     MMLVDPRFGE LAGQFFRLFG QPSDGGGALA LYLHGEPVVD IWSGWAARDT RWQSDTVSVS        60
     FSTGKGVAST VLHRLVDRGL IDYDAPVATY WPEFASAGKE LVTVRDLLTH RAGLHRVRGL       120
     VPGRAALFDH DSVVGALASA APDRRRAVMP GYHAVTFGSL VAELTTRATG SSFTDLVRTE       180
     IAEPLGIREF WFQVPAEERH RIAKSFPRIT PFGVPWETAS FALSCLPVLR NIAHAGMPEG       240
     FDELVRNPAI HDYVMPGWNG VFSARALARM YAALANKGMV GGRRFLTEDT LAQIGEVQTT       300
     ARDYVLGIRM NWRLGYHAAF VASRNQYPHA FGHYGLGGSG AFADPETGLS VAFVTNRMGG       360
     ALTPLADLRL AKLGAQAESI ARRL                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page