(data stored in ACNUC7421 zone)

EMBL: CP000431.PE42

CP000431.PE42        Location/Qualifiers
FT   CDS             complement(47559..48437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00042"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_process: GO:0006950 - response to stress"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00042"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91878"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKQ8"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91878.1"
FT                   /translation="MTYAPTDAVVASETVTMTGGVADHEYSRATSGHRRRCRRSPGYHY
FT                   SEAALLFQNEFAEEVEKSAHEILDRAQQHVKSAVPDVTVSCSTHPGPAGPALAGLSAHA
FT                   EMVVVGSTGAGALQSILTGSTVLQVVNRAHCPVTVFRSEAPSPVPDHRPVVVGVDGSDL
FT                   SSLAITTAVEFATFFEVPLLAVHGWGAGDLPERPAALPMVNWAVVEEEQSVLMAENLAG
FT                   WREKCPDLQLTTVIEQAGPAELILEYARDAQLVVVGSHGHNRLAGAFLGSTSQNLLHHV
FT                   ACLITICRRAS"
     MTYAPTDAVV ASETVTMTGG VADHEYSRAT SGHRRRCRRS PGYHYSEAAL LFQNEFAEEV        60
     EKSAHEILDR AQQHVKSAVP DVTVSCSTHP GPAGPALAGL SAHAEMVVVG STGAGALQSI       120
     LTGSTVLQVV NRAHCPVTVF RSEAPSPVPD HRPVVVGVDG SDLSSLAITT AVEFATFFEV       180
     PLLAVHGWGA GDLPERPAAL PMVNWAVVEE EQSVLMAENL AGWREKCPDL QLTTVIEQAG       240
     PAELILEYAR DAQLVVVGSH GHNRLAGAFL GSTSQNLLHH VACLITICRR AS               292
//

If you have problems or comments...

PBIL Back to PBIL home page