(data stored in ACNUC7421 zone)

EMBL: CP000431.PE46

CP000431.PE46        Location/Qualifiers
FT   CDS             complement(53107..53709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00046"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_component: GO:0016021 - integral to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00046"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91882"
FT                   /db_xref="GOA:Q0SKQ4"
FT                   /db_xref="InterPro:IPR039708"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKQ4"
FT                   /protein_id="ABG91882.1"
FT                   /translation="MTIDQALRWWRLAPWSRNPLMRATDRCDSVVAAVLITVVLIVVPF
FT                   AAAFGTVTYTGLAERSHTELQTRHAQSAVLVDDPRQVVVADARSRSPETQDRGTAQWKA
FT                   PDGTLRSTAVETRPGTHRGDTVTVWVDTNGNVVAEPRSGVQNAAIAVSAALSVWAGAAV
FT                   GALLLYSGVRWISGRSRMRQWDREWNDLGRTPGWPVS"
     MTIDQALRWW RLAPWSRNPL MRATDRCDSV VAAVLITVVL IVVPFAAAFG TVTYTGLAER        60
     SHTELQTRHA QSAVLVDDPR QVVVADARSR SPETQDRGTA QWKAPDGTLR STAVETRPGT       120
     HRGDTVTVWV DTNGNVVAEP RSGVQNAAIA VSAALSVWAG AAVGALLLYS GVRWISGRSR       180
     MRQWDREWND LGRTPGWPVS                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page