(data stored in ACNUC7421 zone)

EMBL: CP000431.PE47

CP000431.PE47        Location/Qualifiers
FT   CDS             53898..54266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00047"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91883"
FT                   /db_xref="GOA:Q0SKQ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKQ3"
FT                   /protein_id="ABG91883.1"
FT                   /translation="MRAPLSHRCGRGRRTTSEPVGEGTRNIMFEGHATASPCDDRHRRD
FT                   DEPEEFLYVHPAGFALSVVTGAAAAGLVVLLGAWLATPLVGVGAAATLVATVGLAAAML
FT                   MPHRPRRHGTRPVRSTAR"
     MRAPLSHRCG RGRRTTSEPV GEGTRNIMFE GHATASPCDD RHRRDDEPEE FLYVHPAGFA        60
     LSVVTGAAAA GLVVLLGAWL ATPLVGVGAA ATLVATVGLA AAMLMPHRPR RHGTRPVRST       120
     AR                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page