(data stored in ACNUC7421 zone)

EMBL: CP000431.PE49

CP000431.PE49        Location/Qualifiers
FT   CDS             55092..56813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00049"
FT                   /product="sensor kinase, two-component system"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_function: GO:0000155 - two-component sensor activity;
FT                   GO_function: GO:0005524 - ATP binding; GO_function:
FT                   GO:0046983 - protein dimerization activity; GO_process:
FT                   GO:0000160 - two-component signal transduction system
FT                   (phosphorelay); GO_process: GO:0006468 - protein amino acid
FT                   phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00049"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91885"
FT                   /db_xref="GOA:Q0SKQ1"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKQ1"
FT                   /protein_id="ABG91885.1"
FT                   /translation="MTRQPDAGDRGPLLGSLSELRLRELLAEVQERIEQIVDARDHVDG
FT                   LLEAMLAVTSGLDLDNTLHTIVHAAINLVDARYGALGVLGPGGGLSEFVFEGIDEETRE
FT                   RIGDLPRGRGVLGFLITNPKPVRLDDLSHHSASVGFPAEHPPMKTFLGVPIQIRDEVFG
FT                   NLYLTEKANGSQFTEDDEVLLRALAAAAGIAIENARLYEESRTRQAWLEATREIATELL
FT                   AGSETAEVLQVIADDALALTGADSAFLAVPDDPDIPSDEVTELVVTASAGTVSDRIIGR
FT                   TIPVDKSTSGEAFRERTPLRVTALAFDPGFETGTRFGPALALPLRAAQSVTGVLVTLRH
FT                   VDALPFTDDQLALMSGFADQAAVALQLANSQRRMRELDVLSDRDRIARDLHDHVIQRLF
FT                   AVGLSLQSTLQRAKAPIVKQRLEQSIDDLHDIVRDIRTAIFDLHGGSGGMTQFRRRLHE
FT                   IVAETTADSGLRTTVHMSGPLSVIDAALADHAEAVLREALSNAVRHAGADTVTVSISVY
FT                   DDLAIEVADDGKGFVENVVTSGLENLAARAREVNGHFAIDTTPGGGTTLRWTAPLP"
     MTRQPDAGDR GPLLGSLSEL RLRELLAEVQ ERIEQIVDAR DHVDGLLEAM LAVTSGLDLD        60
     NTLHTIVHAA INLVDARYGA LGVLGPGGGL SEFVFEGIDE ETRERIGDLP RGRGVLGFLI       120
     TNPKPVRLDD LSHHSASVGF PAEHPPMKTF LGVPIQIRDE VFGNLYLTEK ANGSQFTEDD       180
     EVLLRALAAA AGIAIENARL YEESRTRQAW LEATREIATE LLAGSETAEV LQVIADDALA       240
     LTGADSAFLA VPDDPDIPSD EVTELVVTAS AGTVSDRIIG RTIPVDKSTS GEAFRERTPL       300
     RVTALAFDPG FETGTRFGPA LALPLRAAQS VTGVLVTLRH VDALPFTDDQ LALMSGFADQ       360
     AAVALQLANS QRRMRELDVL SDRDRIARDL HDHVIQRLFA VGLSLQSTLQ RAKAPIVKQR       420
     LEQSIDDLHD IVRDIRTAIF DLHGGSGGMT QFRRRLHEIV AETTADSGLR TTVHMSGPLS       480
     VIDAALADHA EAVLREALSN AVRHAGADTV TVSISVYDDL AIEVADDGKG FVENVVTSGL       540
     ENLAARAREV NGHFAIDTTP GGGTTLRWTA PLP                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page