(data stored in ACNUC7421 zone)

EMBL: CP000431.PE5

CP000431.PE5         Location/Qualifiers
FT   CDS             6935..8449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00005"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0005554 - molecular function
FT                   unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00005"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91841"
FT                   /db_xref="GOA:Q0S093"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR014292"
FT                   /db_xref="UniProtKB/TrEMBL:Q0S093"
FT                   /protein_id="ABG91841.1"
FT                   /translation="MHQLSSLDAQFLDAETSTTCTHVGILSVLGPTTPGGGLTVQALRA
FT                   LADGRLHLVGPLRWRLQQVPLGLDRPYWVDSEFLDLGYHIREVTLTGPGTDEQLAEQIS
FT                   GLAARPLSRDRPLWQCYLVNGLTGGRQAIYTKVHPAVIDGLTAAQALAVLMDTTPQPRT
FT                   VPHRFSDEQYQAAGALGMLGNSAWHLALLPARLMWSSLRLAPHLPELADALTVPGADLL
FT                   GTLARGLTPRTWRRPADEATAGAPAPAPAPPDTPFPGPDTARRRFAFTSLPLGEVDAVR
FT                   TALGCTVDDVVTALCTTVLRRWLIDHDAPPNTTLAAAMPIARRTDAQFAAADHRLSLLP
FT                   IALPINEADPARRLHKVHTSLTAAPQRFRAAPATLVRDVGAALPRALRGPISRTPLRAL
FT                   TMPTPPVNLIISHAAGPARPLYTAGIEVTGNFPVSAVSDMTGGITIAAMSYGRHLDVGI
FT                   ITCRNLVPDVWDVTGQLHQALSELTACTRNVRYLRPARPPHRPMSR"
     MHQLSSLDAQ FLDAETSTTC THVGILSVLG PTTPGGGLTV QALRALADGR LHLVGPLRWR        60
     LQQVPLGLDR PYWVDSEFLD LGYHIREVTL TGPGTDEQLA EQISGLAARP LSRDRPLWQC       120
     YLVNGLTGGR QAIYTKVHPA VIDGLTAAQA LAVLMDTTPQ PRTVPHRFSD EQYQAAGALG       180
     MLGNSAWHLA LLPARLMWSS LRLAPHLPEL ADALTVPGAD LLGTLARGLT PRTWRRPADE       240
     ATAGAPAPAP APPDTPFPGP DTARRRFAFT SLPLGEVDAV RTALGCTVDD VVTALCTTVL       300
     RRWLIDHDAP PNTTLAAAMP IARRTDAQFA AADHRLSLLP IALPINEADP ARRLHKVHTS       360
     LTAAPQRFRA APATLVRDVG AALPRALRGP ISRTPLRALT MPTPPVNLII SHAAGPARPL       420
     YTAGIEVTGN FPVSAVSDMT GGITIAAMSY GRHLDVGIIT CRNLVPDVWD VTGQLHQALS       480
     ELTACTRNVR YLRPARPPHR PMSR                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page