(data stored in ACNUC7421 zone)

EMBL: CP000431.PE50

CP000431.PE50        Location/Qualifiers
FT   CDS             56936..57817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00050"
FT                   /product="possible universal stress protein"
FT                   /note="GO_process: GO:0006950 - response to stress"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00050"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91886"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKQ0"
FT                   /protein_id="ABG91886.1"
FT                   /translation="MTARHPIVVGTDGSPSSLQAVAWAAQEAALRNSPLSVIATTFVPG
FT                   AYGVPIGMPESFFDDEERNGKNRLAAAAEIAARTVPGQSLDIHTTLCTGTPAGELLERA
FT                   KSAAMVVVGSNRQGIIERGFLGSVSAAVATHAPCPVAIIHDLPDSEVTRLEGPVVVGVD
FT                   GSAHSEPAISMAFAEAGLRQCELVAVHAWSDVDLPVHYEGGSVSGWKQIVTQETALLSE
FT                   SLAGRAEDFPDVKVRTMVVMDRPVRNLREQADNARLLVVGSRGRGGFTSMLLGSTSRAL
FT                   MHSVRCPLLVVR"
     MTARHPIVVG TDGSPSSLQA VAWAAQEAAL RNSPLSVIAT TFVPGAYGVP IGMPESFFDD        60
     EERNGKNRLA AAAEIAARTV PGQSLDIHTT LCTGTPAGEL LERAKSAAMV VVGSNRQGII       120
     ERGFLGSVSA AVATHAPCPV AIIHDLPDSE VTRLEGPVVV GVDGSAHSEP AISMAFAEAG       180
     LRQCELVAVH AWSDVDLPVH YEGGSVSGWK QIVTQETALL SESLAGRAED FPDVKVRTMV       240
     VMDRPVRNLR EQADNARLLV VGSRGRGGFT SMLLGSTSRA LMHSVRCPLL VVR              293
//

If you have problems or comments...

PBIL Back to PBIL home page