(data stored in ACNUC7421 zone)

EMBL: CP000431.PE53

CP000431.PE53        Location/Qualifiers
FT   CDS             complement(59344..60093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00053"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00053"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91889"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKP7"
FT                   /protein_id="ABG91889.1"
FT                   /translation="MTSTSSDTETTAMVHTQAPVVERLIPEFEGSFTRDAIARTVAGSI
FT                   ADLARVPIADMPELAERVARQRLFTALERHPERSSSGRCEPTPDNRVIVSHRSGGPGPL
FT                   PSVTTRQSNRRGHDGPAAWARCARVRGGGDQTGARDHVARGDRDTRTRRGADLLPGHGA
FT                   PAPARQGPPRRAGRGRLPLSTRRHSAGQSPDGRRSCFDRPCAPIVRAGSHTGRGCVRTR
FT                   TVISGYEHDSHIVVHPRGGTELHRLRR"
     MTSTSSDTET TAMVHTQAPV VERLIPEFEG SFTRDAIART VAGSIADLAR VPIADMPELA        60
     ERVARQRLFT ALERHPERSS SGRCEPTPDN RVIVSHRSGG PGPLPSVTTR QSNRRGHDGP       120
     AAWARCARVR GGGDQTGARD HVARGDRDTR TRRGADLLPG HGAPAPARQG PPRRAGRGRL       180
     PLSTRRHSAG QSPDGRRSCF DRPCAPIVRA GSHTGRGCVR TRTVISGYEH DSHIVVHPRG       240
     GTELHRLRR                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page