(data stored in ACNUC7421 zone)

EMBL: CP000431.PE55

CP000431.PE55        Location/Qualifiers
FT   CDS             60843..62357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00055"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00055"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91891"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKP5"
FT                   /protein_id="ABG91891.1"
FT                   /translation="MSATERTQRCSPPQAVGGLEVSGVETHTAYVVMVGDVVFKAKKPI
FT                   RTAFADFGTAERRRAACEREVTLNRRLCPDVYLGVAELTDPAGGPTEALVKMRRMPSDR
FT                   RLARLVGGGGDDTTAQVDAIAAVVARFHAGAEQSAEIDCDATPGAVAARWRANVSEVTS
FT                   YRCDVLPAADVHEVQARALRYLKGRKRLFEYRVREGRIVDGHGDLLADDIFCLADGPRI
FT                   LDCLDFDDHLRHVDCIDDAACLAMDLEYLGREDLGSRFLDRYCAAARDEPPASLQHHYI
FT                   AYRAFVRAKVACLRYTQGSRAAGEDARAHCNLALRQLRAGTVRMALVGGLPGTGKSTLS
FT                   RKLADVTGSVVISSDHVRKELDGLDPHSRQVAGFGEGLYSGTMTDRTYAEVLRRARDHL
FT                   TAGRSVVLDASWTQSMRRERAALVASCTHSDLVELECRAPRAMAIARIGSRPTGDSDAT
FT                   PAVYDAMAASAAAWPSATAVDTDTAAGDSVQTAERIWHSTSGWRDE"
     MSATERTQRC SPPQAVGGLE VSGVETHTAY VVMVGDVVFK AKKPIRTAFA DFGTAERRRA        60
     ACEREVTLNR RLCPDVYLGV AELTDPAGGP TEALVKMRRM PSDRRLARLV GGGGDDTTAQ       120
     VDAIAAVVAR FHAGAEQSAE IDCDATPGAV AARWRANVSE VTSYRCDVLP AADVHEVQAR       180
     ALRYLKGRKR LFEYRVREGR IVDGHGDLLA DDIFCLADGP RILDCLDFDD HLRHVDCIDD       240
     AACLAMDLEY LGREDLGSRF LDRYCAAARD EPPASLQHHY IAYRAFVRAK VACLRYTQGS       300
     RAAGEDARAH CNLALRQLRA GTVRMALVGG LPGTGKSTLS RKLADVTGSV VISSDHVRKE       360
     LDGLDPHSRQ VAGFGEGLYS GTMTDRTYAE VLRRARDHLT AGRSVVLDAS WTQSMRRERA       420
     ALVASCTHSD LVELECRAPR AMAIARIGSR PTGDSDATPA VYDAMAASAA AWPSATAVDT       480
     DTAAGDSVQT AERIWHSTSG WRDE                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page