(data stored in ACNUC7421 zone)

EMBL: CP000431.PE57

CP000431.PE57        Location/Qualifiers
FT   CDS             complement(63638..64513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00057"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="GO_function: GO:0008415 - acyltransferase activity;
FT                   GO_process: GO:0008610 - lipid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00057"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91893"
FT                   /db_xref="GOA:Q0SKP3"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKP3"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91893.1"
FT                   /translation="MGTVIDRLDVTRGGWRTRHSALHLAVSAAQTCLERAGRNADDLDL
FT                   LVNVGLYRDRNLGEPALAALIQEDIGAHPEDPHDDTHGTFSFDVANGSCGALNGLQIVD
FT                   GFLRSHTINWALVVASDADPGRGMSEHFPFAPTGGAILCRWTDDEFGLGPVHWVNCSDA
FT                   GESFCATVGLEDSRNVLRFRESDSMDERFATAGAQAARECLEASSLELADVDLIVAAPA
FT                   RPKFRAALAEHLGVPVPRIVVAYDERMHTASLVAALDRRTGGIPAGNRVLIVAVGAGVT
FT                   AGAALYSEHP"
     MGTVIDRLDV TRGGWRTRHS ALHLAVSAAQ TCLERAGRNA DDLDLLVNVG LYRDRNLGEP        60
     ALAALIQEDI GAHPEDPHDD THGTFSFDVA NGSCGALNGL QIVDGFLRSH TINWALVVAS       120
     DADPGRGMSE HFPFAPTGGA ILCRWTDDEF GLGPVHWVNC SDAGESFCAT VGLEDSRNVL       180
     RFRESDSMDE RFATAGAQAA RECLEASSLE LADVDLIVAA PARPKFRAAL AEHLGVPVPR       240
     IVVAYDERMH TASLVAALDR RTGGIPAGNR VLIVAVGAGV TAGAALYSEH P                291
//

If you have problems or comments...

PBIL Back to PBIL home page