(data stored in ACNUC7421 zone)

EMBL: CP000431.PE58

CP000431.PE58        Location/Qualifiers
FT   CDS             complement(64497..65552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00058"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="GO_function: GO:0008415 - acyltransferase activity;
FT                   GO_process: GO:0008610 - lipid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00058"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91894"
FT                   /db_xref="GOA:Q0SKP2"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKP2"
FT                   /protein_id="ABG91894.1"
FT                   /translation="MPFATRLAGAGRHLPTTHLTTTDLMSTTRHSTHIDLERLTGIRER
FT                   RVSVGDEDSYTLAISAALDCLERSNRDAASIDVVVSCSITKFHGGLTQWLEPTMSSAVA
FT                   QAIGAPGAMTFDLSNACAGMLTGVTVMNNWIRQGIVERALVVSGEYISQLGQNAAQHIR
FT                   NIMSKELACLTLGDAGAALLLERAPAGSAGIGLAGFTTVADYSRLCLAYPKGDDPGARM
FT                   FTNSRGIQRAAIADTPLLLHEVLDAAGISLHDIDHVITHQTSARAIRKGMAEVTATLGD
FT                   SPRHDAVITVDRYGNTASTTHTVALVEELEAGRIRAGETVALIALASGLEIGVVLLTLD
FT                   EELVARYGHSH"
     MPFATRLAGA GRHLPTTHLT TTDLMSTTRH STHIDLERLT GIRERRVSVG DEDSYTLAIS        60
     AALDCLERSN RDAASIDVVV SCSITKFHGG LTQWLEPTMS SAVAQAIGAP GAMTFDLSNA       120
     CAGMLTGVTV MNNWIRQGIV ERALVVSGEY ISQLGQNAAQ HIRNIMSKEL ACLTLGDAGA       180
     ALLLERAPAG SAGIGLAGFT TVADYSRLCL AYPKGDDPGA RMFTNSRGIQ RAAIADTPLL       240
     LHEVLDAAGI SLHDIDHVIT HQTSARAIRK GMAEVTATLG DSPRHDAVIT VDRYGNTAST       300
     THTVALVEEL EAGRIRAGET VALIALASGL EIGVVLLTLD EELVARYGHS H                351
//

If you have problems or comments...

PBIL Back to PBIL home page