(data stored in ACNUC7421 zone)

EMBL: CP000431.PE59

CP000431.PE59        Location/Qualifiers
FT   CDS             65779..66369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00059"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0003723 - RNA binding; GO_function:
FT                   GO:0016779 - nucleotidyltransferase activity; GO_process:
FT                   GO:0006396 - RNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00059"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91895"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKP1"
FT                   /protein_id="ABG91895.1"
FT                   /translation="MQARHVMSSPVTTVDRSTSVDECLRLVGSSGFTVLPVVDERKHLV
FT                   GIVSEGDLLRARFRELGGADRGTDPQPDEMSAGDVMASPVVAMTADAEVSELASAMLRS
FT                   RLRGIPIVHDHDILGIVTRPDLIAVLTTDDAQVAKEVQHRLDVYGGAGRWRVDVAHGSA
FT                   AIYGVTPQDPERNVIAALADTVPGIAEVHFPPE"
     MQARHVMSSP VTTVDRSTSV DECLRLVGSS GFTVLPVVDE RKHLVGIVSE GDLLRARFRE        60
     LGGADRGTDP QPDEMSAGDV MASPVVAMTA DAEVSELASA MLRSRLRGIP IVHDHDILGI       120
     VTRPDLIAVL TTDDAQVAKE VQHRLDVYGG AGRWRVDVAH GSAAIYGVTP QDPERNVIAA       180
     LADTVPGIAE VHFPPE                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page