(data stored in ACNUC7421 zone)

EMBL: CP000431.PE6

CP000431.PE6         Location/Qualifiers
FT   CDS             complement(11208..11435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00006"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91842"
FT                   /db_xref="UniProtKB/TrEMBL:Q0S094"
FT                   /protein_id="ABG91842.1"
FT                   /translation="MFVRALHTEMMARNAYIHHKKIEGSQLPLMIAVLDEFFILSGKWQ
FT                   RLAKTGDDATREQPESDSRNSTRERRATRE"
     MFVRALHTEM MARNAYIHHK KIEGSQLPLM IAVLDEFFIL SGKWQRLAKT GDDATREQPE        60
     SDSRNSTRER RATRE                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page