(data stored in ACNUC7421 zone)

EMBL: CP000431.PE60

CP000431.PE60        Location/Qualifiers
FT   CDS             66421..66678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00060"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91896"
FT                   /db_xref="GOA:Q0SKP0"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKP0"
FT                   /protein_id="ABG91896.1"
FT                   /translation="MQARYLDAGDLRWPWVAAAAVVGFAALSMTSPLAVLGGAAAVVFI
FT                   GLGVFRNPHQRVVGAAIVSVGVGLLVPGLPALLLHGVNSL"
     MQARYLDAGD LRWPWVAAAA VVGFAALSMT SPLAVLGGAA AVVFIGLGVF RNPHQRVVGA        60
     AIVSVGVGLL VPGLPALLLH GVNSL                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page