(data stored in ACNUC7421 zone)

EMBL: CP000431.PE61

CP000431.PE61        Location/Qualifiers
FT   CDS             66752..67639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00061"
FT                   /product="possible universal stress protein"
FT                   /note="GO_process: GO:0006950 - response to stress"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00061"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91897"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKN9"
FT                   /protein_id="ABG91897.1"
FT                   /translation="MTTDSPIVVGVDGSAHSLDAVCWAADAAVHHRAPLSSLLGAPGTF
FT                   GDAVNLSAGVFSGVEYAGTQSLATASELARRSVPGNHLTLRTSLRHGSAVAALLDAAES
FT                   ARMLVVGSRGLGEFTGGLVGSVSAAVASHAPCPVAVIRGMPEMDAPPLDGPVVVGVDGS
FT                   PNSEPAIAAAFEEASLRGVDLVAVHAWSDFSLLTVTPADPSDNELPWSAIETAERAVLS
FT                   ERLAGWKDKYPDVSVRKVVVRDRPVHHLLQQARESQLVVTGSRGRGGFASLLLGSTSRA
FT                   LLHALTCPLLIVRR"
     MTTDSPIVVG VDGSAHSLDA VCWAADAAVH HRAPLSSLLG APGTFGDAVN LSAGVFSGVE        60
     YAGTQSLATA SELARRSVPG NHLTLRTSLR HGSAVAALLD AAESARMLVV GSRGLGEFTG       120
     GLVGSVSAAV ASHAPCPVAV IRGMPEMDAP PLDGPVVVGV DGSPNSEPAI AAAFEEASLR       180
     GVDLVAVHAW SDFSLLTVTP ADPSDNELPW SAIETAERAV LSERLAGWKD KYPDVSVRKV       240
     VVRDRPVHHL LQQARESQLV VTGSRGRGGF ASLLLGSTSR ALLHALTCPL LIVRR            295
//

If you have problems or comments...

PBIL Back to PBIL home page