(data stored in ACNUC7421 zone)

EMBL: CP000431.PE62

CP000431.PE62        Location/Qualifiers
FT   CDS             67975..68571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00062"
FT                   /product="possible potassium channel protein TrkA"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00062"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91898"
FT                   /db_xref="GOA:Q0SKN8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKN8"
FT                   /protein_id="ABG91898.1"
FT                   /translation="MDRHISRMTGHAIVCGFGRVGRAGVQYLATLGMPVVVVDRDPERL
FT                   AELDVPTVVGDVTDDQVLEAAGIGHAHALIRAGANRVVTLISSGAPDGCLRAPATRRRV
FT                   LARRDARRDAGLPDRGGRGLACLAAGRANTGGSGPRGATGSLLMALWSPTGQFVADPTP
FT                   EQRLDPGTILIALGTAPQLDALRREVRQSEGIYSP"
     MDRHISRMTG HAIVCGFGRV GRAGVQYLAT LGMPVVVVDR DPERLAELDV PTVVGDVTDD        60
     QVLEAAGIGH AHALIRAGAN RVVTLISSGA PDGCLRAPAT RRRVLARRDA RRDAGLPDRG       120
     GRGLACLAAG RANTGGSGPR GATGSLLMAL WSPTGQFVAD PTPEQRLDPG TILIALGTAP       180
     QLDALRREVR QSEGIYSP                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page