(data stored in ACNUC7421 zone)

EMBL: CP000431.PE64

CP000431.PE64        Location/Qualifiers
FT   CDS             complement(68903..69748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00064"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00064"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91900"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKN6"
FT                   /protein_id="ABG91900.1"
FT                   /translation="MTVLVAYATAKGSTRGIAERLGSCIEGLGQSVDVRPVAAVSDVHS
FT                   YDVIVFGSAIHNGQWLAEASDAVGRLRSQFEGRRVWAFSVSSVGVTSTTLSKRLARFLR
FT                   RVTPEPGAVRILRDAADVRDHRFFAGVIAPGDWPGFGRVVFTLMGGHYGDARDWADVCA
FT                   WAGAIAAESTRDTERRRVWAFSVSSVGVTSTTLSKRLARFLRRVTPEPGAVRILRDAAD
FT                   VRDHRFFAGVIAPGDWPGFGRVVFTLMGGHYGDARDWADVCAWAGAIAAESTRDTERWT
FT                   "
     MTVLVAYATA KGSTRGIAER LGSCIEGLGQ SVDVRPVAAV SDVHSYDVIV FGSAIHNGQW        60
     LAEASDAVGR LRSQFEGRRV WAFSVSSVGV TSTTLSKRLA RFLRRVTPEP GAVRILRDAA       120
     DVRDHRFFAG VIAPGDWPGF GRVVFTLMGG HYGDARDWAD VCAWAGAIAA ESTRDTERRR       180
     VWAFSVSSVG VTSTTLSKRL ARFLRRVTPE PGAVRILRDA ADVRDHRFFA GVIAPGDWPG       240
     FGRVVFTLMG GHYGDARDWA DVCAWAGAIA AESTRDTERW T                           281
//

If you have problems or comments...

PBIL Back to PBIL home page