(data stored in ACNUC7421 zone)

EMBL: CP000431.PE65

CP000431.PE65        Location/Qualifiers
FT   CDS             complement(69745..71229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00065"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_component: GO:0016021 - integral to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00065"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91901"
FT                   /db_xref="GOA:Q0SKN5"
FT                   /db_xref="InterPro:IPR025498"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKN5"
FT                   /protein_id="ABG91901.1"
FT                   /translation="MRTGRVAVLVLGCLSALTGFALLTAAVFLGWAYFMQRDGGHFTSP
FT                   REHFETSESALVSEKVDLFEGADLPKGFSTEDLGRVLVRATATDPDQEIFIGIGPRDEV
FT                   DKYFTDVARTEVTDVQFDPFRPTYRQIPGTRPAALPGTQPFWSASSSGTGTQEVRWELQ
FT                   QGSWTAVVMKADATPGLSVDIQAGARLTFLGPLALSVLVGAVVLLIIGIPLIVAGAIGL
FT                   GRHGPPQPHPVAQIAGDGTIAGDAHVPWTVYPARLVGELDAPLSRWLWLVKWLLALPHY
FT                   FVLFFLGIAFVVTTLVSGFAILFTARYPRTLFDFNVGVLRWVWRVQFYTYSALATDRYP
FT                   PFTLNRTDYPADFDVDYPVRLSRGLVLVKWWLLAIPHYLILALLAGGWFGSWRAGVTVT
FT                   DGTHYGQPWLLGSVLGLAVTFSAIALLFTGRYPHGLFDFVMGINRWAFRVAAYATLMRD
FT                   EYPPFRLDQGPCEPHEPTPHSGGDDSGETSPERPRT"
     MRTGRVAVLV LGCLSALTGF ALLTAAVFLG WAYFMQRDGG HFTSPREHFE TSESALVSEK        60
     VDLFEGADLP KGFSTEDLGR VLVRATATDP DQEIFIGIGP RDEVDKYFTD VARTEVTDVQ       120
     FDPFRPTYRQ IPGTRPAALP GTQPFWSASS SGTGTQEVRW ELQQGSWTAV VMKADATPGL       180
     SVDIQAGARL TFLGPLALSV LVGAVVLLII GIPLIVAGAI GLGRHGPPQP HPVAQIAGDG       240
     TIAGDAHVPW TVYPARLVGE LDAPLSRWLW LVKWLLALPH YFVLFFLGIA FVVTTLVSGF       300
     AILFTARYPR TLFDFNVGVL RWVWRVQFYT YSALATDRYP PFTLNRTDYP ADFDVDYPVR       360
     LSRGLVLVKW WLLAIPHYLI LALLAGGWFG SWRAGVTVTD GTHYGQPWLL GSVLGLAVTF       420
     SAIALLFTGR YPHGLFDFVM GINRWAFRVA AYATLMRDEY PPFRLDQGPC EPHEPTPHSG       480
     GDDSGETSPE RPRT                                                         494
//

If you have problems or comments...

PBIL Back to PBIL home page