(data stored in ACNUC7421 zone)

EMBL: CP000431.PE7

CP000431.PE7         Location/Qualifiers
FT   CDS             12456..12710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00007"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91843"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKU3"
FT                   /protein_id="ABG91843.1"
FT                   /translation="MPSTAGSSRGAYTAAAAPATAIGEVGVKRPMRARSGGRIDLRACA
FT                   CGVAVAEDLAVLLNHPVLDRVTTCVHRGLLSLGPTPLRE"
     MPSTAGSSRG AYTAAAAPAT AIGEVGVKRP MRARSGGRID LRACACGVAV AEDLAVLLNH        60
     PVLDRVTTCV HRGLLSLGPT PLRE                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page