(data stored in ACNUC7421 zone)

EMBL: CP000431.PE70

CP000431.PE70        Location/Qualifiers
FT   CDS             complement(74280..74984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00070"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91906"
FT                   /db_xref="GOA:Q0SKN0"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKN0"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91906.1"
FT                   /translation="MAETQRAQEFRRLRTPRSAAVAGIVFAVLFAASLVLLRTALPADP
FT                   FDETPWVGSGETRIKTALLLAPFAGIAFLWFIGVIRDRLGDLEDRFFATVFLGSGLLFL
FT                   AMGFVSMGVAGGVLAIARHSGSSANDIVYFGREIMLQINHVYALRMAAVFMISLGTIWL
FT                   RTGLMPRWLVMTTYLLALALLAIVDFSLWSTLAFPAWVLLISVYILVTGRRASAADRSF
FT                   RSAPVSWRRSRR"
     MAETQRAQEF RRLRTPRSAA VAGIVFAVLF AASLVLLRTA LPADPFDETP WVGSGETRIK        60
     TALLLAPFAG IAFLWFIGVI RDRLGDLEDR FFATVFLGSG LLFLAMGFVS MGVAGGVLAI       120
     ARHSGSSAND IVYFGREIML QINHVYALRM AAVFMISLGT IWLRTGLMPR WLVMTTYLLA       180
     LALLAIVDFS LWSTLAFPAW VLLISVYILV TGRRASAADR SFRSAPVSWR RSRR             234
//

If you have problems or comments...

PBIL Back to PBIL home page