(data stored in ACNUC7421 zone)

EMBL: CP000431.PE71

CP000431.PE71        Location/Qualifiers
FT   CDS             75236..76717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00071"
FT                   /product="multidrug resistance transporter, MFS superfamily
FT                   protein"
FT                   /note="tc: 2.A.1.3; GO_component: GO:0016021 - integral to
FT                   membrane; GO_function: GO:0003824 - catalytic activity;
FT                   GO_function: GO:0005215 - transporter activity;
FT                   GO_function: GO:0008199 - ferric iron binding; GO_process:
FT                   GO:0006725 - aromatic compound metabolism; GO_process:
FT                   GO:0006810 - transport; GO_process: GO:0046677 - response
FT                   to antibiotic"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00071"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91907"
FT                   /db_xref="GOA:Q0SKM9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKM9"
FT                   /protein_id="ABG91907.1"
FT                   /translation="MMVTHATTERWTPRLIFSLASIVLLLEMLAVSYMMISIALPQIVT
FT                   HYQTTQGAWLLTAFLLVGAITCPLIGKLADTHGKRRLLLTAVGLSALGSLISAIAPTYA
FT                   VLIAGRALTGLLVPCLFLSYSLIRDVFPARTVALAVSIATSGMGLIAIPAPFFTGWLID
FT                   NFGFRSIFWFFVAGLVILAVLIRATTGESTVRLRSRIDLIGAALLGAGLAGILVGVSFG
FT                   PSWGWTSGATIGFLAGGAALLVAWMVSARLLADPLIDIRFFGKRPVFLTALGAGFCYGT
FT                   SAVFTIMLPMMCMTPAILGLGYGFGISAEGFAIFQAPLGGAVVIGGLIVGTLVPRNVRP
FT                   RILMVVGMLVMAAACLLTAMVHDDKALLIGFAALLGVGMGMGYASVPNLLIAAVPPQLQ
FT                   ATTASMVAVFQSILPAILPVIVFSVLNSHIATVVQGAVFYTDTGITIAFVIGAVSALLG
FT                   AVVAFALPRRISQLSAPGSGAAAAADTDGAVVLAH"
     MMVTHATTER WTPRLIFSLA SIVLLLEMLA VSYMMISIAL PQIVTHYQTT QGAWLLTAFL        60
     LVGAITCPLI GKLADTHGKR RLLLTAVGLS ALGSLISAIA PTYAVLIAGR ALTGLLVPCL       120
     FLSYSLIRDV FPARTVALAV SIATSGMGLI AIPAPFFTGW LIDNFGFRSI FWFFVAGLVI       180
     LAVLIRATTG ESTVRLRSRI DLIGAALLGA GLAGILVGVS FGPSWGWTSG ATIGFLAGGA       240
     ALLVAWMVSA RLLADPLIDI RFFGKRPVFL TALGAGFCYG TSAVFTIMLP MMCMTPAILG       300
     LGYGFGISAE GFAIFQAPLG GAVVIGGLIV GTLVPRNVRP RILMVVGMLV MAAACLLTAM       360
     VHDDKALLIG FAALLGVGMG MGYASVPNLL IAAVPPQLQA TTASMVAVFQ SILPAILPVI       420
     VFSVLNSHIA TVVQGAVFYT DTGITIAFVI GAVSALLGAV VAFALPRRIS QLSAPGSGAA       480
     AAADTDGAVV LAH                                                          493
//

If you have problems or comments...

PBIL Back to PBIL home page