(data stored in ACNUC7421 zone)

EMBL: CP000431.PE72

CP000431.PE72        Location/Qualifiers
FT   CDS             76857..81278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00072"
FT                   /product="non-ribosomal peptide synthetase"
FT                   /EC_number="5.1.1.11"
FT                   /note="GO_function: GO:0005554 - molecular function
FT                   unknown; GO_function: GO:0016788 - hydrolase activity,
FT                   acting on ester bonds; GO_function: GO:0016874 - ligase
FT                   activity; GO_function: GO:0048037 - cofactor binding;
FT                   GO_process: GO:0009058 - biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00072"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91908"
FT                   /db_xref="GOA:Q0SKM8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKM8"
FT                   /protein_id="ABG91908.1"
FT                   /translation="MRVRIPGRVVPLTEAQHAIWFAQQLAPEIPYVIAQYVDLRGPVRL
FT                   DLLTEASARAVHELGSFTVREVDGRPHQVFGAGTSERVPVVDLRDEHDPVDAAERWMRK
FT                   DCIAPVDMYGESLVLSTILQVGDERTYWYTRAHHVAMDGYAAMMLMRRTAELYVAGIDG
FT                   DRPPEFRAVDPGRIAADDAGYRSSPRFQRDRAYWREQVRDLPPTVGLSGRRTPNPGASV
FT                   LVARGSADRSSDLLRPTGDGNAHSPTVVVVAAFAAYLARMTGADDVILSLPVSARTSAR
FT                   LRGTGGSVSNVLPLPLRGVGTGTVRDAVRAARTALTGALRHQRYRREDIGKDIASAGTG
FT                   LTHFGPVLNLMLFKQEITLGAVTGRVQVLTTGPTADLAVNIYPGPPGSVPRIDVEANPA
FT                   LYDEDEVTGHHRRFTMFLARFQAAAGTDRSVAELDVFHDAEREAFSPACGRPDSEPAPL
FT                   DRILAATVVTRPDAVAVRDRGRVVTYRELDEAADRWARVLTGHGVGPEDLVAVSIPRSY
FT                   ESVLALWAVARTGAAYVPVDPTHPTDRIAYTLGDSGAALGLTVRSARDRLPTTIRWLSI
FT                   DDGDDHPPTVERDRPVHLGHPAYVIYTSGSTGVPKGAVVTHDGLANLVQEIREKYAVAA
FT                   DSRVLHFASPSFDTALVEVLAACIGGATLVIAPTDVYGGAELRELLRAERITHLLSTPS
FT                   ALATVDPDGLDSLELVLVGGEVCPQDLADRWAVGRTMRNAYGPTETTCSVTLTDPLDPG
FT                   GRVTIGSLMRGVRATVCDPLLRPLPPGAVGELYLATPALARGYHRRPALTATRFVADPS
FT                   GKPGSRMFRTGDRVRWTNSATLEFLERTDDQVKVRGFRIELGEIDAALRRNPDIDFATT
FT                   IVHRTPVGDPVLVSYIMVRRESQTTPESARHAIARFLPEYMVPGSITVLDAVPLTPTKK
FT                   LDRGALPAPDFGTTTVPRRDPETTTERTVADVFGRLLGVPAVAAGDSFFDLGGDSLSAT
FT                   RVVATLNAELDATLGVRELFETPTVSALAERIDDRDASRSGAVRAPRIAATAVPDRVPL
FT                   SPSQQFIDRSATTPPLYSIPFTVRVAGAVDVDALRSAVADVLARHGALRTVFPDSAAGP
FT                   YQRLLSVDDALPDLAPIPAGPDDVADRVDRVLGAPFDVRTEPPLRATLFALDARDHLLA
FT                   CVLHHITADGWSLALVARDLVTAYASRTAGAPPGWEPPRVTYPQYSVWRRDMLGAEDDP
FT                   GSVASQQLAYWTEELSGLPGAVGLPLDRRRPHHWTYGAGRATFRIDHTAHHTLASLAHR
FT                   HHATVFTALRSAVAILLARLSGDTDIAVGTPVAGRNDPELDDVVGMFVNTVVLRTRVDP
FT                   GDTLADVIRDSHDIELRAFAHADVQFERLVEVIDPPRSSSLHPFFQVALSLNNFTPATL
FT                   DVAGLRFDITPRPLDVAKCDLHFHFTERHDTTGRPAGIDAELVYATDLFDGATATSFVD
FT                   ALLAVIGGDPGA"
     MRVRIPGRVV PLTEAQHAIW FAQQLAPEIP YVIAQYVDLR GPVRLDLLTE ASARAVHELG        60
     SFTVREVDGR PHQVFGAGTS ERVPVVDLRD EHDPVDAAER WMRKDCIAPV DMYGESLVLS       120
     TILQVGDERT YWYTRAHHVA MDGYAAMMLM RRTAELYVAG IDGDRPPEFR AVDPGRIAAD       180
     DAGYRSSPRF QRDRAYWREQ VRDLPPTVGL SGRRTPNPGA SVLVARGSAD RSSDLLRPTG       240
     DGNAHSPTVV VVAAFAAYLA RMTGADDVIL SLPVSARTSA RLRGTGGSVS NVLPLPLRGV       300
     GTGTVRDAVR AARTALTGAL RHQRYRREDI GKDIASAGTG LTHFGPVLNL MLFKQEITLG       360
     AVTGRVQVLT TGPTADLAVN IYPGPPGSVP RIDVEANPAL YDEDEVTGHH RRFTMFLARF       420
     QAAAGTDRSV AELDVFHDAE REAFSPACGR PDSEPAPLDR ILAATVVTRP DAVAVRDRGR       480
     VVTYRELDEA ADRWARVLTG HGVGPEDLVA VSIPRSYESV LALWAVARTG AAYVPVDPTH       540
     PTDRIAYTLG DSGAALGLTV RSARDRLPTT IRWLSIDDGD DHPPTVERDR PVHLGHPAYV       600
     IYTSGSTGVP KGAVVTHDGL ANLVQEIREK YAVAADSRVL HFASPSFDTA LVEVLAACIG       660
     GATLVIAPTD VYGGAELREL LRAERITHLL STPSALATVD PDGLDSLELV LVGGEVCPQD       720
     LADRWAVGRT MRNAYGPTET TCSVTLTDPL DPGGRVTIGS LMRGVRATVC DPLLRPLPPG       780
     AVGELYLATP ALARGYHRRP ALTATRFVAD PSGKPGSRMF RTGDRVRWTN SATLEFLERT       840
     DDQVKVRGFR IELGEIDAAL RRNPDIDFAT TIVHRTPVGD PVLVSYIMVR RESQTTPESA       900
     RHAIARFLPE YMVPGSITVL DAVPLTPTKK LDRGALPAPD FGTTTVPRRD PETTTERTVA       960
     DVFGRLLGVP AVAAGDSFFD LGGDSLSATR VVATLNAELD ATLGVRELFE TPTVSALAER      1020
     IDDRDASRSG AVRAPRIAAT AVPDRVPLSP SQQFIDRSAT TPPLYSIPFT VRVAGAVDVD      1080
     ALRSAVADVL ARHGALRTVF PDSAAGPYQR LLSVDDALPD LAPIPAGPDD VADRVDRVLG      1140
     APFDVRTEPP LRATLFALDA RDHLLACVLH HITADGWSLA LVARDLVTAY ASRTAGAPPG      1200
     WEPPRVTYPQ YSVWRRDMLG AEDDPGSVAS QQLAYWTEEL SGLPGAVGLP LDRRRPHHWT      1260
     YGAGRATFRI DHTAHHTLAS LAHRHHATVF TALRSAVAIL LARLSGDTDI AVGTPVAGRN      1320
     DPELDDVVGM FVNTVVLRTR VDPGDTLADV IRDSHDIELR AFAHADVQFE RLVEVIDPPR      1380
     SSSLHPFFQV ALSLNNFTPA TLDVAGLRFD ITPRPLDVAK CDLHFHFTER HDTTGRPAGI      1440
     DAELVYATDL FDGATATSFV DALLAVIGGD PGA                                   1473
//

If you have problems or comments...

PBIL Back to PBIL home page