(data stored in ACNUC7421 zone)

EMBL: CP000431.PE73

CP000431.PE73        Location/Qualifiers
FT   CDS             81330..82697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00073"
FT                   /product="sensor kinase, two-component system"
FT                   /note="GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0000155 - two-component sensor activity; GO_function:
FT                   GO:0005524 - ATP binding; GO_process: GO:0000160 -
FT                   two-component signal transduction system (phosphorelay);
FT                   GO_process: GO:0006468 - protein amino acid
FT                   phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00073"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91909"
FT                   /db_xref="GOA:Q0SKM7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKM7"
FT                   /protein_id="ABG91909.1"
FT                   /translation="MRARSAAAAALVVTICLVLAGGALLLVLYRTLEHSARDAADARAR
FT                   QIVEQLRTTAPGGLDSSLFATDGQVGTIQVIDSAGTVVATSPGADRLPVTFEPVPPGES
FT                   RYLGNIDLGDEPDYWIVERGAQSPQGPATVVVGADREPIEGILGTVALLMAIGGPVVVA
FT                   MVAVASYRLVGAALLPVERIRARVAAISTDRLDERVPVPHTQDEIARLAETMNSMLGRL
FT                   ESGHRAQQRFVSDASHELRSPLATITAALELAHTRPELVDTSLVDESLLPEARRMNHLL
FT                   ADLLLLARADENGLTHTSVDVDIDDLMYAESARVRDMSPELVVRTAIAPVRVVGDPQQL
FT                   ARVVRNLVDNARRHARREIRLNCRTSSDGAVLEVADDGPGIAVPDRQRIFERFVRLDTP
FT                   RTRDSGGAGLGLAIVAEIVATHGGTIDVTDSGTGGARFVITLPADGTRQSSPDFSR"
     MRARSAAAAA LVVTICLVLA GGALLLVLYR TLEHSARDAA DARARQIVEQ LRTTAPGGLD        60
     SSLFATDGQV GTIQVIDSAG TVVATSPGAD RLPVTFEPVP PGESRYLGNI DLGDEPDYWI       120
     VERGAQSPQG PATVVVGADR EPIEGILGTV ALLMAIGGPV VVAMVAVASY RLVGAALLPV       180
     ERIRARVAAI STDRLDERVP VPHTQDEIAR LAETMNSMLG RLESGHRAQQ RFVSDASHEL       240
     RSPLATITAA LELAHTRPEL VDTSLVDESL LPEARRMNHL LADLLLLARA DENGLTHTSV       300
     DVDIDDLMYA ESARVRDMSP ELVVRTAIAP VRVVGDPQQL ARVVRNLVDN ARRHARREIR       360
     LNCRTSSDGA VLEVADDGPG IAVPDRQRIF ERFVRLDTPR TRDSGGAGLG LAIVAEIVAT       420
     HGGTIDVTDS GTGGARFVIT LPADGTRQSS PDFSR                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page