(data stored in ACNUC7421 zone)

EMBL: CP000431.PE76

CP000431.PE76        Location/Qualifiers
FT   CDS             84185..84610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00076"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00076"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91912"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKM4"
FT                   /protein_id="ABG91912.1"
FT                   /translation="MRLTTLGDLPARIATGGFILHSGIQKWSADEQTAQGIHGMAAGAF
FT                   PFLNAIPPERFIKLLSVAEIGTGAALLTPFVPSAVAGAALTGFSGGLVAMYARTPALRN
FT                   PGSIWPNENGIAVAKDVWMLGIGLGFVLDGLSRSRCR"
     MRLTTLGDLP ARIATGGFIL HSGIQKWSAD EQTAQGIHGM AAGAFPFLNA IPPERFIKLL        60
     SVAEIGTGAA LLTPFVPSAV AGAALTGFSG GLVAMYARTP ALRNPGSIWP NENGIAVAKD       120
     VWMLGIGLGF VLDGLSRSRC R                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page