(data stored in ACNUC7421 zone)

EMBL: CP000431.PE77

CP000431.PE77        Location/Qualifiers
FT   CDS             complement(84652..85188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00077"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0004803 - transposase activity; GO_process: GO:0006313 -
FT                   DNA transposition; GO_process: GO:0006725 - aromatic
FT                   compound metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00077"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91913"
FT                   /db_xref="GOA:Q0SKM3"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKM3"
FT                   /protein_id="ABG91913.1"
FT                   /translation="MSVLGQMDSFRRVFPTARRNRADLLRWLRRRPQLLAAVGFHEFAL
FT                   ATSARVDPRLKALGEIKAAALTNCEYCLDIGSAFSRALGVSDAQLRALPKFRESSEFDD
FT                   TEKLVLEFAEAITRTPAHIGEGLRRSLLAEFSEAQLTELAAAIAWENHRGRLNQALGVR
FT                   PSGFSDSDFCVVPEQ"
     MSVLGQMDSF RRVFPTARRN RADLLRWLRR RPQLLAAVGF HEFALATSAR VDPRLKALGE        60
     IKAAALTNCE YCLDIGSAFS RALGVSDAQL RALPKFRESS EFDDTEKLVL EFAEAITRTP       120
     AHIGEGLRRS LLAEFSEAQL TELAAAIAWE NHRGRLNQAL GVRPSGFSDS DFCVVPEQ         178
//

If you have problems or comments...

PBIL Back to PBIL home page