(data stored in ACNUC7421 zone)

EMBL: CP000431.PE80

CP000431.PE80        Location/Qualifiers
FT   CDS             complement(86531..86872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00080"
FT                   /product="possible transposase"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_function: GO:0004803 - transposase activity;
FT                   GO_process: GO:0006313 - DNA transposition; GO_process:
FT                   GO:0006355 - regulation of transcription, DNA-dependent;
FT                   GO_process: GO:0006412 - protein biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00080"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91916"
FT                   /db_xref="GOA:Q0RVL2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVL2"
FT                   /protein_id="ABG91916.1"
FT                   /translation="MAMKAYSAEFKADAVALYLSDPSHTFEGIGNDLGVSRETLRNWVR
FT                   AERKRTGTSTAELRADGAARPASRAGEVSSESVLEEENKQLKAQIRKLETEREILRKAA
FT                   KYFAGETNW"
     MAMKAYSAEF KADAVALYLS DPSHTFEGIG NDLGVSRETL RNWVRAERKR TGTSTAELRA        60
     DGAARPASRA GEVSSESVLE EENKQLKAQI RKLETEREIL RKAAKYFAGE TNW              113
//

If you have problems or comments...

PBIL Back to PBIL home page