(data stored in ACNUC7421 zone)

EMBL: CP000431.PE82

CP000431.PE82        Location/Qualifiers
FT   CDS             87818..88729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00082"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00082"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91918"
FT                   /db_xref="GOA:Q0SKL8"
FT                   /db_xref="InterPro:IPR027948"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKL8"
FT                   /protein_id="ABG91918.1"
FT                   /translation="MPMTSHHPRLQWAVPALLLTLIYAASLTVYGLSSRTGDDDGPFEI
FT                   GSDEVVVLVTAKSLQPTTDRVQAEVTIAVGEDFLHANGDTLNRDITLLLVPSTSHEEIV
FT                   FRAGASATTFDTEFIATGNAAYWPFDRFEVNPMVVEAYQGLGADRELVPTALLLEGRVD
FT                   GWKARAEEVAVDTDLSRNGTGAALMFARTGGNLIYAGILLLMMTILAGLAAFVALQTFR
FT                   RKRAVNTDMLGWMAAMLFAVVPLRGILPGSPPIGSWVDIALTVWVVSTLVASLALFVFC
FT                   WWRDSEAPAQHEVVATRAPGSE"
     MPMTSHHPRL QWAVPALLLT LIYAASLTVY GLSSRTGDDD GPFEIGSDEV VVLVTAKSLQ        60
     PTTDRVQAEV TIAVGEDFLH ANGDTLNRDI TLLLVPSTSH EEIVFRAGAS ATTFDTEFIA       120
     TGNAAYWPFD RFEVNPMVVE AYQGLGADRE LVPTALLLEG RVDGWKARAE EVAVDTDLSR       180
     NGTGAALMFA RTGGNLIYAG ILLLMMTILA GLAAFVALQT FRRKRAVNTD MLGWMAAMLF       240
     AVVPLRGILP GSPPIGSWVD IALTVWVVST LVASLALFVF CWWRDSEAPA QHEVVATRAP       300
     GSE                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page