(data stored in ACNUC7421 zone)

EMBL: CP000431.PE83

CP000431.PE83        Location/Qualifiers
FT   CDS             88738..89190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00083"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0005554 - molecular function
FT                   unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00083"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91919"
FT                   /db_xref="GOA:Q0SKL7"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKL7"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91919.1"
FT                   /translation="MVRRTGTVRPPWYLAHVNKVIVGLHRLGVPMPMPALTVPGRKTGV
FT                   LRSTPVSPYEVDGRRYVVAGYAESDWAKNVLAAGRGELTRGRRRERVRLVALPMSERGR
FT                   ILREFPIRVPHGVTMFLKAGTVANSSPEAFAAAADRCEVFRIEPLD"
     MVRRTGTVRP PWYLAHVNKV IVGLHRLGVP MPMPALTVPG RKTGVLRSTP VSPYEVDGRR        60
     YVVAGYAESD WAKNVLAAGR GELTRGRRRE RVRLVALPMS ERGRILREFP IRVPHGVTMF       120
     LKAGTVANSS PEAFAAAADR CEVFRIEPLD                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page