(data stored in ACNUC7421 zone)

EMBL: CP000431.PE84

CP000431.PE84        Location/Qualifiers
FT   CDS             complement(89196..89708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00084"
FT                   /product="possible secreted copper binding protein"
FT                   /note="GO_function: GO:0005489 - electron transporter
FT                   activity; GO_function: GO:0005507 - copper ion binding;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00084"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91920"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKL6"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91920.1"
FT                   /translation="MKTGTTPARSGASGIRSHRHPEATTMKRVLTLVLPILLAVFALAA
FT                   CGSDGDDSSGSAESAHGGDHPMSGMPSMSMSMPMSMPAGAGQAGGHEILISDFKYTLPG
FT                   TFAPGEEVTVRNNDTAEHTVTADTGDLFDVEVEPGATATFTVPGQPGTFAFHCAYHPNM
FT                   VGTLEVR"
     MKTGTTPARS GASGIRSHRH PEATTMKRVL TLVLPILLAV FALAACGSDG DDSSGSAESA        60
     HGGDHPMSGM PSMSMSMPMS MPAGAGQAGG HEILISDFKY TLPGTFAPGE EVTVRNNDTA       120
     EHTVTADTGD LFDVEVEPGA TATFTVPGQP GTFAFHCAYH PNMVGTLEVR                  170
//

If you have problems or comments...

PBIL Back to PBIL home page