(data stored in ACNUC7421 zone)

EMBL: CP000431.PE86

CP000431.PE86        Location/Qualifiers
FT   CDS             90746..92182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00086"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00086"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91922"
FT                   /db_xref="GOA:Q0SKL4"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKL4"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91922.1"
FT                   /translation="MEPHVRLVTRRRRTGPPQCHRDRRPRHRADAVAHRLRGTCSGVDR
FT                   RLLPLDTRIAGSAEHRTRHDRRGPVSPHRPGHRRQRTAGQSRQTTVTTGAGGHDDSVAQ
FT                   PHSPEQEQPIVAAEEGAARISTAAHPLGKPGPRFDRRSPFFIGMAGAAGVAVTYALIEV
FT                   VLAARGVLVLIAVAAFLAIGLEPAVSWLVRHGFPRWAAVATVFVLAFAVLAGFLAAAIP
FT                   PMVTQGGALVHNAPDYLGHLEQRYPVLEELSTRFHLQDELRRALDASNAPMVVGGLVGA
FT                   GKFVFSAISGTVIVVVLTAYFLADFAHIRSSIYRLAPNSRRPRTILIGDEIFAKVGGYV
FT                   LGNLLISLITAVLTFVWLVAFDVPYPLLLAVLVAVLDLIPVVGSTLAGVVVALVALTVS
FT                   LLVSLATIVFFIALRLFEDYLLVPRIIGRTVKVPPMVTVVAVLIGGALLGIVGALLAIP
FT                   VAAAVLLLARETVFPQLDRG"
     MEPHVRLVTR RRRTGPPQCH RDRRPRHRAD AVAHRLRGTC SGVDRRLLPL DTRIAGSAEH        60
     RTRHDRRGPV SPHRPGHRRQ RTAGQSRQTT VTTGAGGHDD SVAQPHSPEQ EQPIVAAEEG       120
     AARISTAAHP LGKPGPRFDR RSPFFIGMAG AAGVAVTYAL IEVVLAARGV LVLIAVAAFL       180
     AIGLEPAVSW LVRHGFPRWA AVATVFVLAF AVLAGFLAAA IPPMVTQGGA LVHNAPDYLG       240
     HLEQRYPVLE ELSTRFHLQD ELRRALDASN APMVVGGLVG AGKFVFSAIS GTVIVVVLTA       300
     YFLADFAHIR SSIYRLAPNS RRPRTILIGD EIFAKVGGYV LGNLLISLIT AVLTFVWLVA       360
     FDVPYPLLLA VLVAVLDLIP VVGSTLAGVV VALVALTVSL LVSLATIVFF IALRLFEDYL       420
     LVPRIIGRTV KVPPMVTVVA VLIGGALLGI VGALLAIPVA AAVLLLARET VFPQLDRG         478
//

If you have problems or comments...

PBIL Back to PBIL home page