(data stored in ACNUC7421 zone)

EMBL: CP000431.PE87

CP000431.PE87        Location/Qualifiers
FT   CDS             92302..93687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00087"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0004144 - diacylglycerol
FT                   O-acyltransferase activity; GO_function: GO:0005554 -
FT                   molecular function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00087"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91923"
FT                   /db_xref="GOA:Q0SKL3"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR014292"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKL3"
FT                   /protein_id="ABG91923.1"
FT                   /translation="MSVMSPTEAMFVLFETPSHPMHVGALELFEPPRESGPDHARAMFE
FT                   ALISHEGASDTFRRRAVRPLRGASYPWWSFDDRIDLGYHVRHTAVPGRGRMEDLLSLVS
FT                   QMHGMPLDPQHPMWEMHVIEGLADGRTAVFSKIHLSLMDGPAGLRLLHHALSTDPDARD
FT                   CPAPWTPGVAGVPRRESVLPVAVVRAGVRAATSIVGVLPALAKVAYDGVREQHLTLPLQ
FT                   SPPTMLNVPVGRARKLAARSWPIRRLVSVATAAHTTINAVVLAMCSGALRRYLLEQYAL
FT                   PDAPLTAMLPVPLDLGGTMIGPRGRDHGVGAMVVGLATDEADPAARLARISESVEHTNR
FT                   VFGALSHTQFQLMSALAISPILLEPVRRFVDDTPPPFNVMISYMPGPSRPRYWNGARLD
FT                   AVYPAPTVLGGQALSITLTSRSGQLDVGVVGDRHAVPHLQRIITHLETSLSDLEHAVAA
FT                   SGT"
     MSVMSPTEAM FVLFETPSHP MHVGALELFE PPRESGPDHA RAMFEALISH EGASDTFRRR        60
     AVRPLRGASY PWWSFDDRID LGYHVRHTAV PGRGRMEDLL SLVSQMHGMP LDPQHPMWEM       120
     HVIEGLADGR TAVFSKIHLS LMDGPAGLRL LHHALSTDPD ARDCPAPWTP GVAGVPRRES       180
     VLPVAVVRAG VRAATSIVGV LPALAKVAYD GVREQHLTLP LQSPPTMLNV PVGRARKLAA       240
     RSWPIRRLVS VATAAHTTIN AVVLAMCSGA LRRYLLEQYA LPDAPLTAML PVPLDLGGTM       300
     IGPRGRDHGV GAMVVGLATD EADPAARLAR ISESVEHTNR VFGALSHTQF QLMSALAISP       360
     ILLEPVRRFV DDTPPPFNVM ISYMPGPSRP RYWNGARLDA VYPAPTVLGG QALSITLTSR       420
     SGQLDVGVVG DRHAVPHLQR IITHLETSLS DLEHAVAASG T                           461
//

If you have problems or comments...

PBIL Back to PBIL home page