(data stored in ACNUC7421 zone)

EMBL: CP000431.PE88

CP000431.PE88        Location/Qualifiers
FT   CDS             complement(93691..94737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00088"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00088"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91924"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKL2"
FT                   /protein_id="ABG91924.1"
FT                   /translation="MSDTVAQSGTSMPFPKPRGPVSDLLFSILRADVADAEPFVAAARS
FT                   LASSARDSPRAFLFDEDAQICLTALYELHLQGITGVGDEWEWNSDLIAARSALEVPFDA
FT                   AIRDVADAPTGADDVVAALWAMTAPSTAPGLSGHMAHEADLTQFRELLIHRSLNQLREA
FT                   DVHTFGIPRLAGAPKAALVEVQSDEYGGGRPERMHSALFATTMRELGLSDDYAHYIDAV
FT                   PAVTLASLNALSLFGLHRSRLGALVGHLCAVETTSALPSKKYAAGLRRLGFGKAATLFF
FT                   DEHVEADSVHEQIVCRDLAGGLVAARPDVAGDILLGAAACLAFDDLVGDHVARCWEENR
FT                   TSLRQPPG"
     MSDTVAQSGT SMPFPKPRGP VSDLLFSILR ADVADAEPFV AAARSLASSA RDSPRAFLFD        60
     EDAQICLTAL YELHLQGITG VGDEWEWNSD LIAARSALEV PFDAAIRDVA DAPTGADDVV       120
     AALWAMTAPS TAPGLSGHMA HEADLTQFRE LLIHRSLNQL READVHTFGI PRLAGAPKAA       180
     LVEVQSDEYG GGRPERMHSA LFATTMRELG LSDDYAHYID AVPAVTLASL NALSLFGLHR       240
     SRLGALVGHL CAVETTSALP SKKYAAGLRR LGFGKAATLF FDEHVEADSV HEQIVCRDLA       300
     GGLVAARPDV AGDILLGAAA CLAFDDLVGD HVARCWEENR TSLRQPPG                    348
//

If you have problems or comments...

PBIL Back to PBIL home page