(data stored in ACNUC7421 zone)

EMBL: CP000431.PE89

CP000431.PE89        Location/Qualifiers
FT   CDS             95348..95803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00089"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91925"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKL1"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91925.1"
FT                   /translation="MKSVLSALPTRYGPPDSSTLFSWAVEPEHGRLSVVSAPGAGGILV
FT                   VRISGDIDVTTLHTFGNHLDEAINERLPFVLDLTDVQFFCASALPVLGTMAARARRLTV
FT                   PWAVTGNNALRRPLTAMKMAAQIPFCADLEDAFLLVAQGVHQGGRSA"
     MKSVLSALPT RYGPPDSSTL FSWAVEPEHG RLSVVSAPGA GGILVVRISG DIDVTTLHTF        60
     GNHLDEAINE RLPFVLDLTD VQFFCASALP VLGTMAARAR RLTVPWAVTG NNALRRPLTA       120
     MKMAAQIPFC ADLEDAFLLV AQGVHQGGRS A                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page