(data stored in ACNUC7421 zone)

EMBL: CP000431.PE91

CP000431.PE91        Location/Qualifiers
FT   CDS             97292..98362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00091"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00091"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91927"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKK9"
FT                   /protein_id="ABG91927.1"
FT                   /translation="MIRVASVPESHVYVRHLGEPDGGGGDVVRLADPVPADGRKVPGGW
FT                   WPPLMLDPGWISRHHREFDVFHIHFGFDAIEPADMKDIVHELSARGKPLVYTVHDLRNP
FT                   HHPDAGPHLEVLDVLVPAATELATLTEGAAAVIDANWARTATVLAHPHVVERPLVERPR
FT                   PDSDDFVVGVHVKSLRANMDPFPVLDALTRTVAALRGARLQIDIHDEIFRPDSYWYAPN
FT                   AAARLLRYRDADRVDVRVHPYFTDAQLWKYLSSLSVSVLPYRFGTHSGWLEACYDLGTA
FT                   VVAPTCGFYAQQQDCATFGFDEDSFDAASLDRAVRTLHRSATARATWHERATQRRLLAQ
FT                   AHHNLYERALSWRALP"
     MIRVASVPES HVYVRHLGEP DGGGGDVVRL ADPVPADGRK VPGGWWPPLM LDPGWISRHH        60
     REFDVFHIHF GFDAIEPADM KDIVHELSAR GKPLVYTVHD LRNPHHPDAG PHLEVLDVLV       120
     PAATELATLT EGAAAVIDAN WARTATVLAH PHVVERPLVE RPRPDSDDFV VGVHVKSLRA       180
     NMDPFPVLDA LTRTVAALRG ARLQIDIHDE IFRPDSYWYA PNAAARLLRY RDADRVDVRV       240
     HPYFTDAQLW KYLSSLSVSV LPYRFGTHSG WLEACYDLGT AVVAPTCGFY AQQQDCATFG       300
     FDEDSFDAAS LDRAVRTLHR SATARATWHE RATQRRLLAQ AHHNLYERAL SWRALP           356
//

If you have problems or comments...

PBIL Back to PBIL home page