(data stored in ACNUC7421 zone)

EMBL: CP000431.PE93

CP000431.PE93        Location/Qualifiers
FT   CDS             99468..100463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00093"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00093"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91929"
FT                   /db_xref="GOA:Q0SKK7"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKK7"
FT                   /protein_id="ABG91929.1"
FT                   /translation="MIGYYIHHHGTGHRVRASSICAALEAPVTALSSAPVDPGGPFVDR
FT                   VRLARDDRGSSPENPTADGALHWVPAHDVGLRTRMSRIASWVDATRPSLMVVDVSVEVA
FT                   AFVRLLGVPVVMIAMPGERTDPAHRLGYRLADHIVAAWPQAMYDPEWLREFAHKTTFVG
FT                   GISRFDGRASAAGPASSRPRILVLSGTAVTVGDVRRCAHVHRDYRWQALGVPGAPWIED
FT                   PWPELCGADVVVSDAGQNSVAEIAAARRPAIVIAQPRPFGEQSATAHSLASGGLAVSIP
FT                   QWPEVTRWPALLDRALALGGDSWVRWQTAGAATRAAAVIDSLAKRAESAP"
     MIGYYIHHHG TGHRVRASSI CAALEAPVTA LSSAPVDPGG PFVDRVRLAR DDRGSSPENP        60
     TADGALHWVP AHDVGLRTRM SRIASWVDAT RPSLMVVDVS VEVAAFVRLL GVPVVMIAMP       120
     GERTDPAHRL GYRLADHIVA AWPQAMYDPE WLREFAHKTT FVGGISRFDG RASAAGPASS       180
     RPRILVLSGT AVTVGDVRRC AHVHRDYRWQ ALGVPGAPWI EDPWPELCGA DVVVSDAGQN       240
     SVAEIAAARR PAIVIAQPRP FGEQSATAHS LASGGLAVSI PQWPEVTRWP ALLDRALALG       300
     GDSWVRWQTA GAATRAAAVI DSLAKRAESA P                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page