(data stored in ACNUC7421 zone)

EMBL: CP000431.PE95

CP000431.PE95        Location/Qualifiers
FT   CDS             complement(101287..102057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00095"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_process: GO:0007582 - physiological process"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00095"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91931"
FT                   /db_xref="GOA:Q0SKK5"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKK5"
FT                   /protein_id="ABG91931.1"
FT                   /translation="MAETVGERPESMSPKLDNATIAAQLGSLATALDEFNRNSGSQVEM
FT                   SLLLQRVCDQVVDAIADADMAGISLLRDGRVVTVAYTDEAVREIDIPNFQALDGDYFGV
FT                   AGTRKVVKARLGEAAARWPSVADNLDQAGMRSFLSAPLAVDEALAGTLNIYGQGDHGFS
FT                   ELDAVVLLVYTTAIEGLLRSARSVELARNEVSGLTKAMKSRAVIEQAKGIVMALRGVPA
FT                   DQAFEILVAQSQQEHVKLAEVARRIVESVTTNPE"
     MAETVGERPE SMSPKLDNAT IAAQLGSLAT ALDEFNRNSG SQVEMSLLLQ RVCDQVVDAI        60
     ADADMAGISL LRDGRVVTVA YTDEAVREID IPNFQALDGD YFGVAGTRKV VKARLGEAAA       120
     RWPSVADNLD QAGMRSFLSA PLAVDEALAG TLNIYGQGDH GFSELDAVVL LVYTTAIEGL       180
     LRSARSVELA RNEVSGLTKA MKSRAVIEQA KGIVMALRGV PADQAFEILV AQSQQEHVKL       240
     AEVARRIVES VTTNPE                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page