(data stored in ACNUC7421 zone)

EMBL: CP000431.PE96

CP000431.PE96        Location/Qualifiers
FT   CDS             complement(102144..103286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00096"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00096"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91932"
FT                   /db_xref="GOA:Q0SKK4"
FT                   /db_xref="InterPro:IPR010343"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKK4"
FT                   /protein_id="ABG91932.1"
FT                   /translation="MHVTTLRRLRSWAGDGQRNTVVVQSAKAATAAVLAWILAERLLGL
FT                   PQPFLAPYAAVFMIEVTVSRSLRVAGEQLAAVSLGVLLAAAVGMLLDSVTVGVGVAVLT
FT                   GLLLGRWHRFGSSGVWVAVTALLMVTYGDSDQPAILGDRILAIALGAGTGVAVNALLLP
FT                   PLYLRRSERAVTGLGSTATSLLCDVARELREPGTGGQPDRWAERAAHVRVQLDDALDAV
FT                   AWTDESARANMRRAAGPAAAGRKWKPAVVALSEGWPQCTEIVRATSLALAPQPPFGPLD
FT                   PEIRESAAAFVDALADVIRAEFAFADSRDAPVAACRTAEERLRNFEDAVSSHSGLTRGS
FT                   SMSAGSILRPSAAALSLLTGESPASPSGTGSVDGGGPGVE"
     MHVTTLRRLR SWAGDGQRNT VVVQSAKAAT AAVLAWILAE RLLGLPQPFL APYAAVFMIE        60
     VTVSRSLRVA GEQLAAVSLG VLLAAAVGML LDSVTVGVGV AVLTGLLLGR WHRFGSSGVW       120
     VAVTALLMVT YGDSDQPAIL GDRILAIALG AGTGVAVNAL LLPPLYLRRS ERAVTGLGST       180
     ATSLLCDVAR ELREPGTGGQ PDRWAERAAH VRVQLDDALD AVAWTDESAR ANMRRAAGPA       240
     AAGRKWKPAV VALSEGWPQC TEIVRATSLA LAPQPPFGPL DPEIRESAAA FVDALADVIR       300
     AEFAFADSRD APVAACRTAE ERLRNFEDAV SSHSGLTRGS SMSAGSILRP SAAALSLLTG       360
     ESPASPSGTG SVDGGGPGVE                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page