(data stored in ACNUC7421 zone)

EMBL: CP000431.PHOU1

CP000431.PHOU1       Location/Qualifiers
FT   CDS             130844..131491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU1"
FT                   /locus_tag="RHA1_ro00127"
FT                   /product="phosphate transport system protein PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00127"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91963"
FT                   /db_xref="GOA:Q0SKH3"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKH3"
FT                   /protein_id="ABG91963.1"
FT                   /translation="MRTRFAENLDSLSGDLASMCRLSVTAMSEASDALLQADLELAEHV
FT                   IDVSGELDDAAAHWEKRAFALLALQAPVAHDLRFMVGGLHISADLHRMGGLAVHIAKIA
FT                   RRRHPDHVVPDEVLGVFTEMGAVAVAQAKETEQVLQHRDPERARGLLTADEAMDDLHRS
FT                   LFTITQAEDWPHGVQSAVDITLLGRFYERFCDHTVEIGRRVIFLETGSLPEQ"
     MRTRFAENLD SLSGDLASMC RLSVTAMSEA SDALLQADLE LAEHVIDVSG ELDDAAAHWE        60
     KRAFALLALQ APVAHDLRFM VGGLHISADL HRMGGLAVHI AKIARRRHPD HVVPDEVLGV       120
     FTEMGAVAVA QAKETEQVLQ HRDPERARGL LTADEAMDDL HRSLFTITQA EDWPHGVQSA       180
     VDITLLGRFY ERFCDHTVEI GRRVIFLETG SLPEQ                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page