(data stored in ACNUC7421 zone)

EMBL: CP000431.XDHA

CP000431.XDHA        Location/Qualifiers
FT   CDS             136845..138941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xdhA"
FT                   /locus_tag="RHA1_ro00135"
FT                   /product="xanthine dehydrogenase, molybdopterin binding
FT                   domain"
FT                   /EC_number="1.17.1.4"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00135"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91971"
FT                   /db_xref="GOA:Q0SKG5"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKG5"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91971.1"
FT                   /translation="MTLVDPKVIGTSAERLDAHDKVTGTALYAFEYPVDEPTYLHPILS
FT                   TIGRGRVTAMHTADAEALDGVLAVLTVFDAPRLADTSDGELAILQDAEVHFRGQFVGAV
FT                   VAESPEVARHGASLVRVDYDVESHDTDFRSGRGDLYTPEDVNAGFPTDTEDGDVDAALS
FT                   AAAVTVDQVYSTAMEHNNPMEPHAAIARWTPGGSGPVLTLHDSTQGVHSVRQTLAPLFG
FT                   LEVEQMRVIAPYVGGGFGSKGLPHAHDVLVVMAAQRVEGRPVKFALTRQQMFALSAYRT
FT                   PTVQHIRLGADADGRLTALSHEAVVQSAKIKEFAEQAAVPSRLMYSTPTRYTTHRLASL
FT                   DVPAPSWMRAPGETPGMFAAEVAMDELAEACGLDPIELRIRNEPEVDPSTGRPWSGRRL
FT                   TDCLREGARRFGWADRDATARARSDSQWQVGMGVASATYPANTSPGSVARIVYDSDGTY
FT                   TVQIGSVDIGTGAWTALTQIAADALGCPLDAIVLQIGDTNLPSATVAGGSTGTSSWGSA
FT                   IVAAARAFRDAHGTSPDPGAEARAGTPDNPDAEKFALHSFGAHFVEAHVHRDSCEIRVE
FT                   RMLGVFAIGRVINARTVRSQLLGGMTMGISMALHESSVNDPRFGHVVTQDLASYHVSTH
FT                   ADIRYLDAVCLDDVDEHANPMGSKGAGEIGIVGAAAAVANAVRHATGVRVRKAPIHLDD
FT                   LLPG"
     MTLVDPKVIG TSAERLDAHD KVTGTALYAF EYPVDEPTYL HPILSTIGRG RVTAMHTADA        60
     EALDGVLAVL TVFDAPRLAD TSDGELAILQ DAEVHFRGQF VGAVVAESPE VARHGASLVR       120
     VDYDVESHDT DFRSGRGDLY TPEDVNAGFP TDTEDGDVDA ALSAAAVTVD QVYSTAMEHN       180
     NPMEPHAAIA RWTPGGSGPV LTLHDSTQGV HSVRQTLAPL FGLEVEQMRV IAPYVGGGFG       240
     SKGLPHAHDV LVVMAAQRVE GRPVKFALTR QQMFALSAYR TPTVQHIRLG ADADGRLTAL       300
     SHEAVVQSAK IKEFAEQAAV PSRLMYSTPT RYTTHRLASL DVPAPSWMRA PGETPGMFAA       360
     EVAMDELAEA CGLDPIELRI RNEPEVDPST GRPWSGRRLT DCLREGARRF GWADRDATAR       420
     ARSDSQWQVG MGVASATYPA NTSPGSVARI VYDSDGTYTV QIGSVDIGTG AWTALTQIAA       480
     DALGCPLDAI VLQIGDTNLP SATVAGGSTG TSSWGSAIVA AARAFRDAHG TSPDPGAEAR       540
     AGTPDNPDAE KFALHSFGAH FVEAHVHRDS CEIRVERMLG VFAIGRVINA RTVRSQLLGG       600
     MTMGISMALH ESSVNDPRFG HVVTQDLASY HVSTHADIRY LDAVCLDDVD EHANPMGSKG       660
     AGEIGIVGAA AAVANAVRHA TGVRVRKAPI HLDDLLPG                               698
//

If you have problems or comments...

PBIL Back to PBIL home page