(data stored in ACNUC7421 zone)

EMBL: CP000431.XDHB

CP000431.XDHB        Location/Qualifiers
FT   CDS             135856..136848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xdhB"
FT                   /locus_tag="RHA1_ro00134"
FT                   /product="xanthine dehydrogenase FAD-binding subunit"
FT                   /EC_number="1.17.1.4"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00134"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91970"
FT                   /db_xref="GOA:Q0SKG6"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKG6"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91970.1"
FT                   /translation="MIPFDYERATDVDSAVATVTGDPRASFLAGGTNLVDHMKLGVARP
FT                   HLLVDVSRLPLGDVVELPDGGLRIGAAVRNSDLAAHDVVRARYPMLSRALLSGASGQLR
FT                   NLATTAGNLLQRTRCVYFQDVTTPCNKREPGTGCSAIGGYVRYHAILGASEHCVAVHPS
FT                   DMAVAMTALDGVVVVRGADGERRIPLSEFYRLPGDRPDRDTVLAHGDLVTAVELPPPPS
FT                   GNRSAYRKVRDRASFAFAVVSVAAELTIGDTSITSARVALGGVAHRPWRATLAEEVLVG
FT                   SPPTEATYTEAAAAELAAAQPLPGNEFKVALTRRVLASVLRSLAEEARR"
     MIPFDYERAT DVDSAVATVT GDPRASFLAG GTNLVDHMKL GVARPHLLVD VSRLPLGDVV        60
     ELPDGGLRIG AAVRNSDLAA HDVVRARYPM LSRALLSGAS GQLRNLATTA GNLLQRTRCV       120
     YFQDVTTPCN KREPGTGCSA IGGYVRYHAI LGASEHCVAV HPSDMAVAMT ALDGVVVVRG       180
     ADGERRIPLS EFYRLPGDRP DRDTVLAHGD LVTAVELPPP PSGNRSAYRK VRDRASFAFA       240
     VVSVAAELTI GDTSITSARV ALGGVAHRPW RATLAEEVLV GSPPTEATYT EAAAAELAAA       300
     QPLPGNEFKV ALTRRVLASV LRSLAEEARR                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page