(data stored in ACNUC7421 zone)

EMBL: CP000431.XDHC

CP000431.XDHC        Location/Qualifiers
FT   CDS             135332..135859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xdhC"
FT                   /locus_tag="RHA1_ro00133"
FT                   /product="xanthine dehydrogenase Fe-S binding subunit"
FT                   /note="GO_function: GO:0005489 - electron transporter
FT                   activity; GO_function: GO:0005506 - iron ion binding;
FT                   GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00133"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91969"
FT                   /db_xref="GOA:Q0SKG7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKG7"
FT                   /protein_id="ABG91969.1"
FT                   /translation="MNVADSPRYRKITLTVDGEERNLEVDTRTTLLDALRDHLGVTAPK
FT                   KGCDHGQCGSCTVLLDGRRSTSCLTFAVAHHGERVVTAHGLADGEVLHAVQQAFVEQDG
FT                   LQCGYCTPGQICSVIGMLDEFLALHPSAVTENLTAPPELTDDEIRERMNGNLCRCGAYP
FT                   NILAAIRQAAEA"
     MNVADSPRYR KITLTVDGEE RNLEVDTRTT LLDALRDHLG VTAPKKGCDH GQCGSCTVLL        60
     DGRRSTSCLT FAVAHHGERV VTAHGLADGE VLHAVQQAFV EQDGLQCGYC TPGQICSVIG       120
     MLDEFLALHP SAVTENLTAP PELTDDEIRE RMNGNLCRCG AYPNILAAIR QAAEA            175
//

If you have problems or comments...

PBIL Back to PBIL home page