(data stored in SCRATCH3701 zone)

EMBL: CP000435.AHCY

CP000435.AHCY        Location/Qualifiers
FT   CDS             115967..117397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahcY"
FT                   /locus_tag="sync_0108"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="identified by match to protein family HMM PF00670;
FT                   match to protein family HMM PF05221; match to protein
FT                   family HMM TIGR00936"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45626"
FT                   /db_xref="GOA:Q0IDX7"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDX7"
FT                   /protein_id="ABI45626.1"
FT                   /translation="MVATAAATAELQVAKDYVIADIGLADFGRKELNIAETEMPGLMAL
FT                   RAKYGKDKPLKGARIAGSLHMTIQTAVLIETLVELGADVRWASCNIFSTQDHAAAAMAA
FT                   GGIPVFAVKGETLEEYWDYTHSILEWGDGGTPNMILDDGGDATGLVMLGSKAEQDITVL
FT                   DNPSNEEETFLFASIKKKLAKDSSFYSRIKAEIQGVTEETTTGVARLYKMQKSGELPFP
FT                   AINVNDSVTKSKFDNLYGCRESLVDSIKRATDVMVAGKQALVVGYGDVGKGSAQSLRGL
FT                   GATVCIAEVDPICALQAAMEGYRVVRLEDVVDQMDIFVTATGNYQVIRNEHLVKMKDEA
FT                   IVCNIGHFDNEIDVASLKSYEWDNIKPQVDHITLPSGNKIILLAEGRLVNLGCATGHPS
FT                   FVMSNSFTNQVLAQIELFTKGSEYGKEVYVLPKHLDEMVARLHLEKIGCKLTELSKDQA
FT                   DYINVPVEGPYKPDHYRY"
     MVATAAATAE LQVAKDYVIA DIGLADFGRK ELNIAETEMP GLMALRAKYG KDKPLKGARI        60
     AGSLHMTIQT AVLIETLVEL GADVRWASCN IFSTQDHAAA AMAAGGIPVF AVKGETLEEY       120
     WDYTHSILEW GDGGTPNMIL DDGGDATGLV MLGSKAEQDI TVLDNPSNEE ETFLFASIKK       180
     KLAKDSSFYS RIKAEIQGVT EETTTGVARL YKMQKSGELP FPAINVNDSV TKSKFDNLYG       240
     CRESLVDSIK RATDVMVAGK QALVVGYGDV GKGSAQSLRG LGATVCIAEV DPICALQAAM       300
     EGYRVVRLED VVDQMDIFVT ATGNYQVIRN EHLVKMKDEA IVCNIGHFDN EIDVASLKSY       360
     EWDNIKPQVD HITLPSGNKI ILLAEGRLVN LGCATGHPSF VMSNSFTNQV LAQIELFTKG       420
     SEYGKEVYVL PKHLDEMVAR LHLEKIGCKL TELSKDQADY INVPVEGPYK PDHYRY           476
//

If you have problems or comments...

PBIL Back to PBIL home page