(data stored in SCRATCH3701 zone)

EMBL: CP000435.AMT

CP000435.AMT         Location/Qualifiers
FT   CDS             complement(303678..305150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amt"
FT                   /locus_tag="sync_0293"
FT                   /product="ammonium transporter"
FT                   /note="identified by match to protein family HMM PF00909;
FT                   match to protein family HMM TIGR00836"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47657"
FT                   /db_xref="GOA:Q0IDE4"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDE4"
FT                   /protein_id="ABI47657.1"
FT                   /translation="MTTAYESPNTRRKSRLQEASLLEGPMLLLQSIRGFKTNRSLLWLG
FT                   CVPLALFGLGLFNLSAHAAEMPELNAAFLANNLWLLVATILVIFMNAGFAMVEAGMCRQ
FT                   KNAVNILAKNLFVFALAVTAYWFVGYSLMYGNAIAAGWLYFNGLFFDPAVTPELISEAG
FT                   LVPSVDFLFQAAFAGTAATIVSGLVAERVKFGEFVVFSLILTAFIYPIAGSWEWNGGWL
FT                   NSVGDKEFIDFAGSSIVHSVGAWAGLIGAMLLGPRIGKFIDGKPQAIPGHNMAIATLGA
FT                   LILWIGWYGFNPGSQLAMDQWVPYVAVTTTLAAAGGAIGATVISTLTSGKPDLTMIING
FT                   ILAGLVSITAGCGNLTFVGSWVAGLIGGIIVVFAVSALDASGIDDPVGAFSVHGVCGVW
FT                   GTLVVGLWGFDIQGDGSPLGLLVGGGISQLGIQALGCAAYAIWTIVTCWIAWSVIGGLF
FT                   GGIRVTEKEEVEGLDIGEHGMEAYPDFVSSGR"
     MTTAYESPNT RRKSRLQEAS LLEGPMLLLQ SIRGFKTNRS LLWLGCVPLA LFGLGLFNLS        60
     AHAAEMPELN AAFLANNLWL LVATILVIFM NAGFAMVEAG MCRQKNAVNI LAKNLFVFAL       120
     AVTAYWFVGY SLMYGNAIAA GWLYFNGLFF DPAVTPELIS EAGLVPSVDF LFQAAFAGTA       180
     ATIVSGLVAE RVKFGEFVVF SLILTAFIYP IAGSWEWNGG WLNSVGDKEF IDFAGSSIVH       240
     SVGAWAGLIG AMLLGPRIGK FIDGKPQAIP GHNMAIATLG ALILWIGWYG FNPGSQLAMD       300
     QWVPYVAVTT TLAAAGGAIG ATVISTLTSG KPDLTMIING ILAGLVSITA GCGNLTFVGS       360
     WVAGLIGGII VVFAVSALDA SGIDDPVGAF SVHGVCGVWG TLVVGLWGFD IQGDGSPLGL       420
     LVGGGISQLG IQALGCAAYA IWTIVTCWIA WSVIGGLFGG IRVTEKEEVE GLDIGEHGME       480
     AYPDFVSSGR                                                              490
//

If you have problems or comments...

PBIL Back to PBIL home page