(data stored in SCRATCH3701 zone)

EMBL: CP000435.ARGH

CP000435.ARGH        Location/Qualifiers
FT   CDS             15764..17182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="sync_0013"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="identified by match to protein family HMM PF00206;
FT                   match to protein family HMM TIGR00838"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46333"
FT                   /db_xref="GOA:Q0IE70"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IE70"
FT                   /protein_id="ABI46333.1"
FT                   /translation="MAGGVTGGGSATWSDRFEQGLHPAIERFNASIGFDITLLQEDLDG
FT                   SIAHARMLADCGVIQVEEADQLVGGLEQVRQEAASGLFQPGLADEDVHFAVERRLIALL
FT                   GPVGKKLHTGRSRNDQVGTDLRLWLRRRLDELEQHLLGFQRALLDQANLHSNTLIPGYT
FT                   HLQRAQPLCLAHHLLAYVEMVERDRQRMADLRKRLNLSPLGAAALAGTPVPIDRRSTAS
FT                   ALGFDGIYANSLDAVSDRDFTVEFSAAASLVMVHLSRLAEEVIFWASEECGFVRLTDRC
FT                   ATGSSLMPQKKNPDVPELVRGKCGRVFGHLQGLLTMIKGLPLAYNKDFQEDKEALFDVV
FT                   ATTSQCLEAMTILLQEGLSFRTERLEAAVAADYSNATDVADYLVAKQVPFREAYQLVGA
FT                   VVKHCLQEGVLLRELTLERWQQFHPAIEADLFEALTPRNVVAARTSEGGTGFDRVNEQL
FT                   AIWNQRFGLADQVF"
     MAGGVTGGGS ATWSDRFEQG LHPAIERFNA SIGFDITLLQ EDLDGSIAHA RMLADCGVIQ        60
     VEEADQLVGG LEQVRQEAAS GLFQPGLADE DVHFAVERRL IALLGPVGKK LHTGRSRNDQ       120
     VGTDLRLWLR RRLDELEQHL LGFQRALLDQ ANLHSNTLIP GYTHLQRAQP LCLAHHLLAY       180
     VEMVERDRQR MADLRKRLNL SPLGAAALAG TPVPIDRRST ASALGFDGIY ANSLDAVSDR       240
     DFTVEFSAAA SLVMVHLSRL AEEVIFWASE ECGFVRLTDR CATGSSLMPQ KKNPDVPELV       300
     RGKCGRVFGH LQGLLTMIKG LPLAYNKDFQ EDKEALFDVV ATTSQCLEAM TILLQEGLSF       360
     RTERLEAAVA ADYSNATDVA DYLVAKQVPF REAYQLVGAV VKHCLQEGVL LRELTLERWQ       420
     QFHPAIEADL FEALTPRNVV AARTSEGGTG FDRVNEQLAI WNQRFGLADQ VF               472
//

If you have problems or comments...

PBIL Back to PBIL home page