(data stored in SCRATCH3701 zone)

EMBL: CP000435.ASNB

CP000435.ASNB        Location/Qualifiers
FT   CDS             complement(187219..189033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnB"
FT                   /locus_tag="sync_0178"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /note="identified by match to protein family HMM PF00310;
FT                   match to protein family HMM PF00733; match to protein
FT                   family HMM TIGR01536"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46358"
FT                   /db_xref="GOA:Q0IDQ7"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDQ7"
FT                   /protein_id="ABI46358.1"
FT                   /translation="MCGIFGGFSFEASAFSGELPVMMAKSILHRGPDNTGYWSNEEALL
FT                   GNCRLSIIDLSKNGNQPFYSKNKDIVVVQNGEIYNYIELRDLLIGEGACFQSDSDTEVV
FT                   LHAYAIWGPDFVSRLNGMFSIAIYDSRVSTAVLRLYRDRLGVKPLYYCIDGGCLWFGSE
FT                   IKAILAAGVKANPNYNALRSYFALNYIPPPQTAFANIYHLQPGHSAAITKSGVKLNRYW
FT                   DCNDIGLNEDITTAEAKSGIITLLDDAVRIRLRSDAPFGAFLSGGLDSSSVVGLMSLYK
FT                   ESPTKTFSIGFEDARYDETSYAEMASKRFGTYHSTKIMSENALDIWSKFIWHCDQPHGD
FT                   ISFIPTYQVSENASQEVKMVLTGDGGDELFAGYDKYASFFSGECDRSHPRWFSDYAQFT
FT                   GLIEADMAKRLFKGEIKASFEENDPYAPITESMLRFGQDDHINKVLYADTVNLLPGNNL
FT                   VKPDRMAMAHSLEVRSPFLDYRLVEYAFSLPGKMKLKGTETKYIYKMAVEELLGETLTW
FT                   RKKQMFTVPVGDWFRGHLADFCSRILLDNRSLSRGLYAESVLREVIEDHTSARKNYTRL
FT                   LRALISLEIWFRLFIDQDMSNLELITSK"
     MCGIFGGFSF EASAFSGELP VMMAKSILHR GPDNTGYWSN EEALLGNCRL SIIDLSKNGN        60
     QPFYSKNKDI VVVQNGEIYN YIELRDLLIG EGACFQSDSD TEVVLHAYAI WGPDFVSRLN       120
     GMFSIAIYDS RVSTAVLRLY RDRLGVKPLY YCIDGGCLWF GSEIKAILAA GVKANPNYNA       180
     LRSYFALNYI PPPQTAFANI YHLQPGHSAA ITKSGVKLNR YWDCNDIGLN EDITTAEAKS       240
     GIITLLDDAV RIRLRSDAPF GAFLSGGLDS SSVVGLMSLY KESPTKTFSI GFEDARYDET       300
     SYAEMASKRF GTYHSTKIMS ENALDIWSKF IWHCDQPHGD ISFIPTYQVS ENASQEVKMV       360
     LTGDGGDELF AGYDKYASFF SGECDRSHPR WFSDYAQFTG LIEADMAKRL FKGEIKASFE       420
     ENDPYAPITE SMLRFGQDDH INKVLYADTV NLLPGNNLVK PDRMAMAHSL EVRSPFLDYR       480
     LVEYAFSLPG KMKLKGTETK YIYKMAVEEL LGETLTWRKK QMFTVPVGDW FRGHLADFCS       540
     RILLDNRSLS RGLYAESVLR EVIEDHTSAR KNYTRLLRAL ISLEIWFRLF IDQDMSNLEL       600
     ITSK                                                                    604
//

If you have problems or comments...

PBIL Back to PBIL home page